ELF̡4s4 (444ԀԀ?U?U@U@@TIl/lib/ld-linux.so.2T6&\*_  r%oBH|~`.d$hOU;SA4J-w#e[L7p>3v:8kGNgY^D2WZ"+zCi(]Mq}c'19, uFa=K5 !P{nI)tjmf?E@Vs0yX/RbQ lx< #9@h?@1 EPQ"bl"h "m>l"(""(h,"̝l,l,3l |ܛ̟);CM(U_j\|L\7|<Lܜ#<0ܠ?,KFl3U|a'hܟtl$< ܝ <vg|[L,̞" l("q)\6<cE,jXpa,cp c}<J|,Jܙ\L3 L"|"%"*3":|%L|f,Ow"}"""<"-?2P"̜"̛t|  ""LP+̙$2ܚ{9PPD "J̚`PV̠)]<}c j "uLJzܞ)"\"""\"\&" @L""H ","""\HH  ̡ @".. __gmon_start__libm.so.6_DYNAMIC_GLOBAL_OFFSET_TABLE__init_fini_IO_stderr___errno_locationfrexpmodfatexitlibX11.so.6callocfreemallocfprintfexitmemsetreallocXAllocColorCellsXBellXSetWindowColormapmemcpyXResizeWindowXCheckIfEventXCloseDisplayXFreeGCXUnloadFontXClearAreaXMoveResizeWindowstrncpy__ctype_bsprintfXCopyAreaXCopyPlaneXCreateBitmapFromDataXCreatePixmapXCreateGCXPutImageXCreateColormapXCreateSimpleWindowXDisplayNamegetenvXDrawArcXDrawLineXDrawLinesXDrawPointsXDrawRectanglestrcatXFillArcXFillPolygonXFillRectangleXFlushXLoadQueryFontXFreePixmapstrcpyXAllocColorXGetIconSizesXGetImageXGetRGBColormapsstrncmpXMapWindowXNextEventXOpenDisplayXParseColorXPendingXPutBackEventXQueryColorXQueryPointerfopensscanffcloseXReadBitmapFileXSelectInputXSetBackgroundXSetClipRectanglesXSetFontXSetForegroundXSetFunctionXStoreNameXSetLineAttributesXSetRGBColormapsXStoreColorXStoreColorsXSetIconNameXDrawStringXTextWidthXGetVisualInfoXMatchVisualInfoXWriteBitmapFileopencloseread_IO_putcunlinkXSetWMNormalHintsXStringListToTextPropertyXSetWMPropertiesfreadfflushioctlwritefcntlXRefreshKeyboardMappingXLookupStringlibc.so.6_exit__libc_init_first__sigsetjmplongjmpsignalkillputenvrandsystemgetcwdmemchr_IO_stdout_printfperror_IO_stdin_ftellexeclpopenfilenofseekpclosestrcasecmptimelocaltimegettimeofdaygetitimersetitimerlseektimeswaitalarmforkgetpid_environdup2pipechdirlinkmktemp__environenvironld-linux.so.2_start_etext_edata__bss_start_endsHPv5k6cytT!,<|J NV) @$(,0x4u8'<@pD HLL1PXTX\` dbhlRpntx|Gj9AU _Qgdm/* "C{roil[P;]} I&E? B$f(a,0D48<W@wDFH`L+P~TX4\^`qd-hl pt7xS|KM03=.H8O\z2(h:Ye%#Z$> US[Ça t^]]5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0% h` %hh%hp%hx%h% h%$h%(h%,h%0h%4h%8hp%<h`%@hP%Dh@%Hh0%Lh %Ph%Th%Xh%\h%`h%dh%hh%lh %ph(%th0%xh8p%|h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0% h` %hh%hp%hx%h% h%$h%(h%,h%0h%4h%8hp%<h`%@hP%Dh@%Hh0%Lh %Ph%Th%Xh%\h%`h%dh%hh%lh %ph(%th0%xh8p%|h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h 1tRX^DHPPRVJh@XN&PUS=tЃ;u]ÍvUÐUh\<ÐU@BU,fxt j^+EÐ  |XÉUÍvUWVS@$Ћ0@ ЉE^SǃSVWT Wu e[^_UWVS@$Ћ8@$Ћ@ Љ1zu:thtSBC?~jd8S !u@ShJWPjPhnhqhq7$FvjdW]Sj8PhySS hÃuhƒuRjPhWWNWEPSjdhS,SjWà W=|t]=|u5=Dt5D=t5jjS@P9‰օ}r$)‰) jjS55S(9t h8SYh‰DEPR]D0ӡy}DD0щˍ8PP=D0щˉHjhP(8Pt j,h't[^_ÍvUVS7ƃu hzu1XvSÐEP9t; u08u },u h'v}t he[^U@$ÉUS]SxSA@PA@P]ÉU,S]S4Sr B@PBlPhԸ]SmS@$P]ÐUEPEEP<$$@ PjU@B P<ÉU@BPÉUWVSDžM9R$ҋDž197~rv D R ‹T |ZF979O}BQWPwWyPuwW CvhuJ ku.t4΋_)Kx6 KyOQwG197~TLF97卥[^_ÉU@B P<ÉU@BPÉUhsÐU@$p=ÍvU@BЋp ÉUj@B 0ÍvUj@B0mÍvUj@B 0ÍvUj@B0MÍvUj@B 0ÍvUj@B0}ÍvUj@B 0ÍvUj@B0]ÍvUWVS}] ƅt uuwv~97} ht e[^_ÉUWVS}] K ƅt uu?~ hm~97} hSt g e[^_ÍvUVS@$Љ@$Ћ PsSVe[^ÐUS@$Љ@$ЋpPS3P} ]US]E HP5DD5HSP7]ÉUWVS@$ЉE=Dt5H5Du0=<19D~#5@<0щMC9DRup5<Vo1ۃ9D~/@40щMV?C9DӍe[^_ÍvU PUS]LwSUVS@$Ћ0@$Ћ=Dt5D_DCHP‰DC5HPRp FPƒ}A$))‰F5PR =|tQ=|u5t SjhvU|PÐUSg`]ÐUE)Pu FPS t1A)ǃ u9]tuFuA8uC9}1e[^_ÐUWVSEu ~uV)9~ЉÅ|51ɍE9}uD2u 8D1uBA9U9uKy1e[^_ÍvUÍvU@$@$@$ÐUSjjjj@$0S]UVS|X1PP9|u TH9\ uFt |xu hVXj1uPV|PRpp`e[^ÐUjjjjhP=ÍvUjjjjhu ÉUjjjjhuÉUWVS}]5|Lj| JB҉VRu<=t}!Eu1vuh(뵐5PuuVuu uM 95|twL95|uuY9uM|zuB|MJ]bM JMJu |RM u |9sjgg0jh` e[^_US==tXT=T u/d h\ `@~ TT PuT T PTuT]ÍvU|txtÐ@u|@`@|@|USX9T~PL \XQS@$P]ÐUvwGPS3ƃ u0)11ۃuu1VS e[^_ÐUS@$h08SSSux01P4UVS@$ЉÃu3h*V t VSd+3h3 SS?[^ÐUVS@$Ћ0@$ЋhV8VhSpS SVJ u-0RÃ9v8Pu 0(ÍpP^1Sh[^ÉUEH$HPhhhhhhhhhhHhhh`hPPHhhhhhhXhHÐÐÐÐÐUWVSu} uWVà u!9=t u5Vmà tVvxKx9D_9u+Gpv h1UGKyɡUe[^_ÐUWVSu] }1ɅtKCSЍ )Ix&vB9uB Iyݸe[^_UEP5|RP%E-PÐU|Hx vRHy-PÍvUdVSsơ|-9| =;wVh']SS@ Ơ5 ve[^ÍvUÐUWVSuCS` $x\  X릉뜃=?덐 0{vK"t5S$>t5S4 CCCC‰~lvCCCC‹   9~ 9 v=)׉=hCRe[^_ÉUS]j,jhCDC +  @@jC=%]ÉU@j=|1ÐÍvUS] |xu hj,jhUD@@ j 9t8u9t h:]ÐU|@P5MÐUS[|@P58uKje|@9~94@j=t]ÐUpWVSUU U P0:SHSU 2P U PhS2 jjSqS/ hU%jPS5j jRSj jy 1t FO)ȃ(jPSSjj2j)‰PS(Pru hXS5j5S?1S" u u[^_ÐUP0hhcjLUÍvUSM1ҡ9P~v  9S]UVS1ې,f<t-tFuE>:uE8u E vuUӉ0эy~L Mu>%~UuzE~~/u ~.tMjEuDPEM1҃9U~ CAB9U~u~/u ~.t/A] 19U~fCAB9UVj0u)V/EM1҃9U~vCAB9U/A] 19U~CAB9Uuuu }uEUvu؍e[^_ÐUS@ Љ{u]8uh7vuu@ P]ÍvUS@ Љ{u]8uh7vuu@ P<]ÍvUS@ ЉV{u]68u h;5uu@ P]ÍvUS@ Љ{uLTfu\]<8"uhA7vuu@ P]ÍvUS@ Љ{ull d]n8"u hs5uu@ P]ÍvU@ Ѓxuvt|fuɃ$@ PU@ ЃxufEtfEuh Ðك$@ PPÉU@ ЃxuvfEtfEuh SÐك$@ PU@ Ѓxuv$@ P*U@ Ѓxuvfuh B$@ PU@ Ѓxuvfuh - <$@ PU@ Ѓxuvfuh $@ PrUS@ Љ{u]EfE@tH8"uhM7vuu@ P]ÍvU@ ЃxuvfEuh $@ PU WVS@ :ЉƋU~= j@$PWE6u}4]䐋MKȿ EEE*Mʀ0}K-*MKȿ EEE*Mʀ0}։)ߋExWSPyvj  e[^_ÍvUWVS=}@$ЋX SpEx-u~ Kp EKx11" &ȍ KyE1+EPPF}Ջ}=j e[^_ÐUS@ Љ@ Ѓ{u 3P PSi]US@ Љ@ Ѓ{u 3PH PS]U@ ЉyuEP$ EPAPR0؃ EHPuÍvUVS@ Љ{uV$vV$]EfE@t8"u h4uu@ Pe[^ÐUWVS@ Љ@ Љ@ Љ@ PSVWe[^_ÍvUTÐUTPЉ)щ )ʍTT1QR,$$R PUVSjTe[^UjUS@ ЉjCPR@ P"]ÐUuh褺ÐU=8thź聺jRU塸}7@u?@ h=XtU塸}7@u?@ h=XuU塸}7@u?@ h8ÐUS@ ЃxurvUȺfuUкfuGEPuu* ȺfD@u"E}E Em$[m vػ} hƒ)ӡ} hzƒ|9|8} yq8} v}8@u?@v h]ÉUWVS\`R ҉R ҋHNR ҉ER ҉Nj};@u?R htÃWwtuVuVute[^_ÐU9\u|9`  \|`}<@u ?Rv hvtPR ңd}@u  R ҋH R ҋH }@uphl1Ƀ=uBu=u h=htg dyu[QBuN=lt9!9}tËpÉdRhR^ =lth5du5dhvUx-w h}7@u?@ h<xxx |f@ÍvU|fHyf@h'xxxÍvU x|Rx|f@ÍvU|PxxffPiÍvU|PxxffPUVS0} h_ƃ ATAe[^ÉUVSu,ub,De[^ÐU|9sjgU塌9|r+v9|r|9sjgHÉUPx=@tRU@x@tÉPUÍvUhغ#ÐUSR ҉R ҋKH]ÍvUS@ Љ@ Љƒ{uzu9% RSX]ÍvU@ P@ PXÍvUS@ Љ@ PSK%X]ÍvUVS@ Љ@ Љ@ PSVe[^UVS@ Љ@ Љ@ PSVe[^UVS@ Љ@ Љ@ PSVe[^UVS@ Љ@ Љ@ PSVe[^UWVS@B Ћ8@ f;@u' )hi+wx9w hC|)‹De[^_ÐUWVS@BЋ8`@$f;@u' )h+wx9w hKC|)‹De[^_ÐUWVS@B Ћ8E1M9~;+\:x9\: hED؉EF97X f;@u$ )hC|)‹DMȉe[^_ÉUWVS@BЋ8E1M9~;+\:x9\: hED؉EF97X$f;@u$ )hC|)‹DMȉe[^_ÐUVS@$Ћ0@$ЉËF9C} hR3}3e[^UWVS@$Ћ0@$Ћ1ۋV9PuxuXe[^_ÉUWVS@$ЋE@$ЋURU9P}x}}uUz%XAuXMFVCC)‰ЅuI1Ʌ uU}9W~ Xe[^_ÍvUWVS@$Ћ@$ЋESU9P}x}}uUz%XDvs]MFVCC)‰ЅuI1Ʌ uU}9Wu Xe[^_ÍvU WVS@$Ћ8@$ЋE@$ЉƋOUJMu6U9u%M9N| Q hR%v9>uuVÉ uVÃG؃UMqRPs 9tSGwPR\ USM9uQe[^_U WVS@$ЋEEEMËU9Z}Z}1@$Љ+]7JvM9uY}u SWhk9_| S1 vhRRƍVUMUD SPu? 77'SWƍNMUMDSPu ^e[^_ÉUS]M U9sJx!ACJy9vJx KIJy]ÉUWVS@$ЋE@$ЉE@EƅN9}}}9} 9u}u)UR)‰UEuM1蹿UvUM9EE9A| P衾 vhR¾ÍKUVPQ趣 t3uEMqPu藣 ;MLMU)MRPun U2 MNE}~EPu/ËUSE)PD;PP(\3]EMqPu e[^_UWVS1@$Ћ@ У@$У@ У5HIxJ=FVDWu$AN9u #vDWt1Í\Ё?BIyxu5 Se[^_ÉUWVS5E]CSNy!x}H*$<v\\\\\\\\\\\\\\\ |CSNxx9UuKF UEKFErECSNx)Pu_t$uE vCSNyKF+}}W5λx}}HM1E}WDPt ЈAMyE DQt$\.u JvDQtHet ECSN-t+uCSNxqDQtjCSNyKFuWEt7E.vECSNx1"u#CSNx"tKFE+}} vCSNyu5螺}xWuP/ E+P5qu5c5e[^_ÐU WVSE=|2} hƃux9} h聹xz  fBfBB2} hyƃx+]]Nx]C]Ny2} h"ƃ5=xNxvGNyR&'$000000,0L0000040|0000l0500 hc%G ~ h蒷195~Bvhh߻F95h諻Ph+ PR ҋ]HK]R$ҋGv RQ  RQ0<]R eR$E RQ "v RQ҉ER ҉@EvR$҉0覵E+v2} hƃfgE]fsS5|NP`fgEfC]xfB 2} h菸ƃ)uxv9}t2v hm xAAffQf]fYϋ x+M xxrx<W5v9}t xffQf]fY=|t| JB  x|])xJ R$e[^_ÉUS=t= xffQ|BZ |]ÐUVS||zt r|ZփKx#vz} RRβKy | xQ|tY:uYQx뀋|JB J R$e[^ÍvUhÐUEu ÐU@$Ћp_ÐUWVS@$ЋE@$ЋE茵P}1ҋuvuuvu}u9}BPtE@PlE9E}]W\׉u\>E)PuFPS t1A)ǃ u9]tuFuA8uC9}jPe[^_U WVS@$ЋE@$ЋExHu~uV)9~ЉÅ|81ɍE9}uD2u8D1uBA9U9u CPvKyj膴e[^_ÉUWVS@$ЋE@$Ћ诳H{Ury19};u 5vCP.]9}WUDPub uC9|jóe[^_ÍvUWVS@$Ћ8@$ЋHsWJ9~Ѕ|5u /CP)]Å|VD;Pu襕 uKyje[^_UWVS@$ЋE@$Ћ3H{Ury19};u @P5CP.]9}WUDPu tC9|jGe[^_ÍvUWVS@$Ћ8@$ЋrHsWJ9~Ѕ|5u @P/CP)]Å|VD;Pu) tKyj茱e[^_UWVS@$ЉE0xٰҰEGNOLu7vW讞ǍGPv贞SuƉ^UUT>}ۅ}1N9~vD;PhPu蛫E  CUU9FFML0bvE KEEU)9VFD2e‰ЋM"D1 ED1KGe[^_ÐUWVS@$ЋE]EOR1EGNOLu/EM9A} E MDEu}1} EM9A~}t\E MDÃLۉ)MM9Q~D MÃ}tuENGS踮e[^_US@ Љj@$P藩A{u ]UڊABABA BA BA BA BA BA]ÉUS@$ЋJzu81ۊB$<uB %=uCt+A$ A A A A A AthL`vBEBEB EB EB EB EB EBEuEv9} $@ Pg]ÉUWVS@$Ћ{W@$PbxsX19} vFDPtЈCA9|e[^_ÍvUWVS@$Ћ{W@$PƦxsX19} vFDPtЈCA9|e[^_ÐUWVS>@$Љ@ ЉNjU@ Ѕu PV4au PuZOu PWAu P7g0u PV!u Puh0h豌e[^_ÐUVSuF^d~!h\5hzh{u;8*u6= t5 Fjj * @0= t5 jCSċ SVPgh B 5$u Ke[^UWSU t =$tjR jh&0 KSRSh P趌e[_ÍvUU~5hhYÍvУ h B U5$u 臜ÐUVSu=$t PvjVXe[^ÐUWVS]Cs~5hhÊ8*ug=t5蓏jjG*=t5hjj*h B yqvjC@PNjC@PSW薤19}):,tB@9|9}ӍSRBW S.h B  WҎ5$u 8e[^_UWS]0Ѝx=t5荎~)jhӻS訊 ujj(jlv~'jhٻSz ujjj>~'jhSN ujjΈjjGP蹈WSP,e[_ÐUWS]0Ѝx=t5赍~)jhSЉ ujGPNjB~+jhS袉 ujGP jvjGP WSP|e[_ÐUWVS1=$=u ==u 0==u0=ЍX*0=ҋ=ЍCPjXǡ8ruE=uhhWp vh5hWRv8iu>=uhhW! h5hWF8ouV=uh hWى h 5hW辉Su SWPYvSut5 t5hPg 55hPIW@e[^_U=uT=uK=uB5 hh  ='h 5hhÐ= u5h 诂5 h+h 裈 =uh.h 踅 v5h h0h f=u5h z5h h6h *=uh.h ?5h h;h =th hDhބUS]=$t;tp5$B ׃h 5$B TuW=~h 5h\hx$ p5 5$B 蒇($S]ÍvUE=$t8u( p5 5$B ?(Ívp5 5$B (ÉUuhh 褆EPÐUWVS6/@$Ћ0@ ЉEVUjF@P܂ǃuF@PhvhjF@PVW\ =(u(= B t=$t h B =(tpu B X<u B ju B X,u B XHu B XLuW5 B fu X@@Su X,Au XH2u XL"uuW5 荁à WɆSu4e[^_US[=u"PjJyLPL=xu|^ |x du v9u=xu x=xu x=tS@ P]ÐUVSEPEP55Kg  @>)Ã=q5 5 5$B ~ P P B>u)Ɖ@PB,u)Ɖ@P5 5q 5$B ?(=tJ P P B>u)Ɖ@PB,u)Ɖ@P5 55$B 5 5 5$B "~EP A,U)BRA>u)Ɖ@PR5 5q 5$B (=t?EP A,U)BRA>u)Ɖ@PR5 55$B 讁5 5 5$B }v5 5 5$B e}EP A,U)BRA>u)Ɖ@PR5 5q 5$B 9(=t<EP A,U)BRA>u)Ɖ@PR5 55$B e[^UEPEP55d=5 5 5$B | P P B>M)@PB,M)@P5 5q 5$B (= P P B>M)@PB,M)@P5 55$B 蜁5 5 5$B { P P B>M)@PB,M)@P5 5q 5$B 6(=tJ P P B>M)@PB,M)@P5 55$B 5 5 5$B { 5$B  ÍvU ~=u=L9H~ jaÍvjjsL9Hj<É=xtU=tWXÐEXÐUS臙ÅuPv=t~ S47)u h S]ÉU\WVS=uJ=t5B0= Rjz5 PxC=t5jjzPP5$B u+5~P5hhzj~v $B B \ ]B |=B = % ]1ډQR,$}E Em<$ZYm B B %B 1ډQR,$}E Em<$ZYmɉ(B  }U Um m B }U Um m=uC  B  (B =u  /v= =~B slB 3^=t+= =~ B v7B 6*= =~B | B <=u;=u25B ݉5 B B ݉(B   $B B t8t455(B 5 B 5 5 tPgvq $h hq $B B tP{u!=t5h%hw j(j(h5q 5$B "x =u% B  B (B B  B =B 1QR,$ 0B }U UmB mB 1QR,$ }U UmB m ,B }U UmB m }U UmB m/vB B B B B B ==~H=~B  vB =~B  vB UURjhv u5h`h%vjzURjhu u5hhujyEE UEUEURURhB jURURUR5q 5$B w$h/#5q 5$B yh ;[ fr:f+r,f5 fZ>fZ@f Rh 5q  5q 5$B ur$e[^_ÍvU=tÐU p5$B s=$t B p5$B s=t5py5 5$B ,s5$B rÍvU@ Ѓ=~5P者ÉjUVSv=ty=tp5$B qÍEPlvpuPEPWv=t%=t9|=t @F5$B [qÃt=th 5$B v  0$t)-,l+0,111001)1111 11111@*111111111P110= ==t KmB ]= B 9 u (B 9 t  B  (B fEMMf B fEf(B MM E=tM=u B jjEPjj5 5$B Io=u==t =(B 9 u B 9 t$B =t=umM=L  B  (B 3v tRw ttw B   0,0h0h,'   q 848h8h4 B   @<@v tNw tVtoJ B   0,0h0h,f   q 848h8h42 B   @<@h@h<%A EPEP5hA h |oE hv }uKvEw,E EPEP5hA h nE^wU=t0}Ct}cu=tjr=t ,1҃=Xv}t }u"=t }ujj=wE w[v }u.EwEEB"w uv} t }u } t }u } u q}u ]}Qu I}Su 5}Ru !}Tu  }u }u *}u +}u -}u /}u 0}u 1}u2p}u3`}u4P}u5@}u60}u7 }u81}u9=t,1҃=tXt P EP=|=t5hhk h m|=t5hh~k j_ov=t5h,hNk 9 v= t=u 5$B hÃ==|e[^ÍvUWVSu=xu*j25$B uk5h]hja0A Ѝx1ۅu%u vA P+C9}9u҃=xtɸe[^_UU9u =xukx =du 9u&5h]hixÃ=xu xÍvU\VSu ]EPju5$B bnsP5$B l $B B t46Qg( $B B t86Qj $B B T4 D8 W5P5L5H5D65$B le[^ÍvU5B 5B 5hhhÉU5B 5B 5hhhÉUE=uuhh!h\hÉ=uu h%؍vH$4444Q5Q55455h_hgÍv= # 4`5hhg\ÉÉ= tÐUS@ Ѓu 0v5P|x]ÍvUjJUWVS蒄苄脄E|ǍEPEPVS{MEPEPuWjM }t0}t*juuuu5q 5$B i5$B ie[^_ÐU ÐUÐU0S]= 5= 4`5h̿hfjEPjEPj5  5$B g=t5hhe =\txto<$ uSjEPjEPj5  5$B fu!=t45hhge<$ tq E 1=tu35h)heEЉq }и w UЋC  $ EЉC S5  5$B d]ÉU,S= t= t = u6= 4`5hchhd EEPEPj 5$B auX=tE 4`5hhd=t5hhc B vjP5q 5$B neÃ=t5h"hc 9  u =5hCv  =t5hhTc 5  5q 5$B d1 9v6C q  $ @9w#v=t5hhb1]ÍvU4WVS $B B T$ T( T0   T8 \8 D4 =  q =  w C  r =  w C   =5h3]̐SVN5 5B 5$B ctF=tI4`5hhMa=t!uuu5hh#aM=ǣ= v  5  q =  w C  r =  w C   =t`5h5h[`IẸB 9 t(=t4`5hnh#`5 e[^_UWVS1۾9cEP4\5  5$B at =\=t4\5h h_[ffEfDfEfDfE=u(%PEPEP5h-h:_]<$ EP Eq $ v=u'EPEPEP5hmh^ [MfMȿf1fЋEfMf1f%}D>fMȿf1fЋET< EP5  5$B Xa uE=t.4\5hh ^hh] _=u'EPEPEP5hh]Eq }0uw EC  C=\uh9=\t=~ =tB55h2h.]=t55hZh]e[^_ÍvUt$=5hh\Ã=t5hh\ Zt=tI5hu35hhn\5hhY\jB`ÉU$B B D0 t  Ð1UWVSjEPEP $B B tQ-`u=th5h&QM9t,yu=tD5hS-EEFvEx u+=t5hhe[17QEPEPj5$B XljE9s(EtU ѐGt9C t(9rjV $B B tQ\E$B B 9L0u!=t5hhZ MU  A@Q B‹YCAEPj ZEEtxEU9PuvxMt|ȋ|1sxUfL19K va1]|tt1v xfx|EfTUfDGA19^wA9N wEEtU9PHuuE05$B rXjuu $B B tQIZh[^_ÐU = u=thhYÍvÉU WVS@$Ћ@ ЉjC@POXƉ1҃9S~DAB9SEPV5  5$B *ZuV5hshMXj=t'EPEPEP5hmhXEP5  5$B [ u(5hhWhhWjj=t'EPEPEP5hhWEq }0uw EC  PWhe[^_UWVSt@$Љƒ< tM< t9 0 Elj)E}wPu$dTvxTTTTTu)u'u)uf ff fEv]fEuuf B fEf(B uu EjjEPjj5 5$B >E}u> x:@,)5 5 5$B EuމuVWE)@EPG])S5 5q 5$B {K(=WVWuS5 55$B NK2=t^5 5 5$B tEEPWE)@PE@P5 5q 5$B J(5 5 5$B 0E uuuu5 5q 5$B C==t^5 5 5$B DEPWE)@PE@P5 55$B `J(5 5 5$B D uuuu5 55$B  C=t5 5 5$B MD 5$B ?Ijjh jj5 5$B !C uJe[^_ÉU0c=u jcÉg=B t 5B =tjvjUc=B t=tB ÍvB Uh*hWh 5$B wIu1h 5$B |DÐUE 8 t1ÐÐU`b=u jbÉ=ujbÉU0bÉU$bÉUbÉU bÉUSa@$ЋjC@PC‰ C@PSRy^=u5 5q 5$B lA]ÍvUWVSraR ҉R ҉R ҉R ҃u]~u]{u]xu]UfEt0UfEt]fEt]fEu/؃=~hRhBh/g[E]fÈ@rE]fÈ@s*=~hhBBh0[==EeB 1QR,$}E Em<$ZYmREeB 1QR,$}E Em<$ZYmRE}E Em<$ZYmRM}E Em<$ZYmR5q 5$B M@D:E E EB EB e[^_US^^^~h/Y~=u/=t&PS5q 5$B s?5$B (DGC  =u(B B   ]ÐU WVS]R ҉R ҉R ҉R ҃u]E~u]E{u]Exu]EfEt2fEt!fEtfEu:؃=~hh>h/WfEtfEu2؃=~hh>h0}WB 1QR,$}U Um$^m}U Um$[mB 1QR,$}U Um$Xm}U Um$Ym0B ,B   =t QPSVe[^_ÉUED=t$5P5L5HP5 5$B PAÉU@WVS@$Ћ@$ЉEZEЃ{~$jC@PuUu̿Pu Emu̿d tu̿n uq U7u̿y uUu̿ uUu̿uB Uu̿uB Uu̿jUԋ@@Pk;ËUԋB@PRSVSb9EuEjuT@0E0ЍxWuTpWSVv<u̿uXjUԋ@@P:ËUԋB@PRSdUS:ǃ=WShh:vu̿ uuj?eu̿ uu ?vu̿ uu< vu̿uUЉu̿uUЉu̿0 uxjUԋ@@P9ƋUԋB@PRV@TEFEEE܋FE؃}uP5$B j6juRSh= u̿guu#vu̿uuuvu̿ uUЉu̿u`Uԋx=j@@P8ËUԋB@PRS1SS5q 5$B ; 5$B !hU7 h ,P}t;uhV]S:0ЍxWu^PpWSV78 }tu;e[^_ÉU WVSzTsTlTEdT]T9}9ukhZj)@EPE)XSVW5 5q 5$B 9$=hZjuSVW5 55$B 9cvhZj)EPE)SVW5 5q 5$B @6$=t'hZjuSVW5 55$B 6$5$B B9e[^_ÉUEuH%uHvuSH=t@5P5L5H5D5 5$B 9=t 5$B 8ÉUWVSRRRR)t)tf= f5 f f jjh jj5 5$B G25$B <8e[^_UWVSRRKRDR=R9~]9~Y)؉EP)WSV5 5q 5$B 8=t uWSV5 55$B 75$B 7e[^_U WVSQE@B Ћ} DEBtzO BB}Wjc31ۃ9MffffDM}u'TRPRP5 5q 5$B 5عC9}}uGjSV5 5q 5$B T0=tojSV5 55$B -0O}uIjjSV5 5q 5$B E1=t jjSV5 55$B 1)C9]}uOjWV5 5q 5$B L5=jWV5 55$B !5}uNjWV5 5q 5$B W/=jWV5 55$B ,/dv}thZh1[jjWV5 5q 5$B /0=t jjWV5 55$B 05$B 4Vb6e[^_ÉUS@$@ Љ5h|h0jSYB]UUvR5hh0É==B 1QR,$ }M Mm$ZmR }M Mm$ZmRB 1QR,$ ,B }M Mm$ZmR 0B }M Mm$Zm*v5B j5B jÐ(B RR B RRÐUHWVS}]u=tAhh/5(B 5 B h4h/VSu WhRhr/;E0}̉]ЋU Uԉu؍EP5q 5$B 2,5$B 2e[^_ÐUEw ÉP5huh/UWVSL@ ЉE@ ЉE@ ЉǃuB  50Rvu q 582vuFB  5@vPu\?SuS?VWL?e[^_UjOt賹ÐEPEPEPEPEPEPEP5q 5$B .$t,E죨B E @<h@h<SÐ=t5h/hF- B UjtÐEPEPEPEPEPEPEP5q 5$B W-$t,E Eq 84h8h4Ð=t5h/h,q  UjtSÐEPEPEPEPEPEPEP5q 5$B ,$t,EB E 0,h0h,Ð=t5h/h+ B U@B Ћ@B Ћ@B hh=+ÍvUWV@$ЉEP2#u1t FO)ȃtuuvutu*uEu tuu utuuu tuuuulutuu5utuuutuuutuu utuu Uu tuu u tu,u u/ tu:u u=tuBu xuEtuIu D=~u5hLhW'}t u6,h @+v55 5$B m* }tu+e^_ÐUfEUUf B fEf(B UU EjjEPjj5 5$B '$=tj5 5$B ) jj5(B 5 B jj5 5q 55$B 4%(=t55 5$B ) 5$B )jjh jj5 5$B #ÍvU WVS@ ЉE@ ЉE@ ЉE@ Љ@ Љ@ Љ5 B u^65(B uP6 Pu@6 PW26 jV'6jS6e[^_ÍvUfEUUf B fEf(B UU EjjEPjj5 5$B !jj5(B 5 B jj5 55q 5$B #Djjh jj5 5$B !ÍvU=t55$B  5 5(B 5 B 5q 5$B i(ÐUWVSJAEBAE@$Ћ8w_=8tSV,cM M G=u%K7hPF!'Ky> > =(t& p5 5$B  &( >EPEPuEHPX 5 5 5$B ! P P B>M)@PB,M)@P5 5q 5$B n&8=tJ P P B>M)@PB,M)@P5 55$B &==EPEP55q5 5 5$B   P P B>M)@PB,M)@P5 5q 5$B %8=tJ P P B>M)@PB,M)@P5 55$B 4%5 5 5$B j = vEPEPuuujG@Pm ËG@PWS;$=t5 5 5$B  P GP B>M)@PB,M)@P5 5q 5$B a$(5 5 5$B  wSuu5 5q 5$B #==t5 5 5$B C P GP B>M)@PB,M)@P5 55$B #(5 5 5$B  wSuu5 55$B jS1$=t5 5 5$B  M MO 5$B k"e[^_ÍvU,WVS~ 6 . &  tS5 5$B  +E@Puuujj5 5q u5$B (=t1+E@Puuujj5 5u5$B (5$B Ct55 5$B  jjh jj5 5$B e[^_ÍvU=uIjj#uhhXjABBÐUWVSu=uS5$B u~S5h=hW5$B uGh75$B ouW5h=hj=t2h7=t"W =tS5hVh]e[^_ÐUSM] UJƒ U J‹ BH]ÐU(WVS6E6E6E6E6E؃}EP]SUM؍DPufEPEPuuS @LE}+}Gu+u EPSE+EPu! UPLЉE}EuEPVWuP5 q PP5$B (=t(uEPVWuP5 PP5$B (5 5 5$B W5$B LEPEPE+EPuq EPEPuu[E+E@PE+E@Puu5 5q 5$B ,=t0E+E@PE+E@Puu5 55$B i5 5 5$B 5$B e[^_UWVS444E4E4E4E|4Stuq   jjj5 B Vj5q 5$B %  jWP@HУq  9  t(VWhq 8uuuu P@DЍe[^_UWVSv5q EPEPhq uUU P@Djjj5 B uj5q 5$B j 0jVP@H v9u |#^9] | jVP@HЉރ 9q t؉u9q tNuuN jVP@HЃ 9q u89u#^9] jSP@HЉރ 9q t9q uU9Uu~v9}~ v 5  jSP@LЃC9]j5B ujjj5 5 5q 5$B y(5$B KUBUU9UuVuV6UJUU9UZuVuVEe[^_UWVS] P@Djjj5 B u j5q 5$B  $jSP@HЉC 9]9=q tA9]|%s9u| jSP@HЉlj 9=q u9=q t 9]tU9=q u9]|8u Shq %9]|3C9E}눍v jSP@HЉC 9=q tdve[^_U}%ÍvUWVSu} SuCUCS:e[^_ÉUWVS}] uj ‰rBe[^_U,WVS000@ ЉE@ ЉE@ ЉE@ ЉE~v9 B rn~j95(B rb(B @)jjjjPS5q 5$B   jjP@HЉá P@DЃ w C PuShi5hzhju.9 B 95(B (B @)jjjjPS5q 5$B   jjP@HЉá P@DЉ]EP5  5$B EP<$EP<$]EP<$U]ԃ$uH"(uuu7"uuu)">vhi5hzhju!ju! ju!e[^_ÐU8WVS@$Ћ-E-E@ ЉE@ ЉE@ ЉEjC@PHƃuC@Phvh{jdC@PSV) =tV5hhFUURUURUURUUR}WV5q 5$B Qà =t$uuuuWV55$B $à =t5hh uuu uhuV5hhuV5hhouV5hhQjujujuV=tuu5hThjE+E@Puuujj5 5q u5$B  ,u5$B { e[^_ÍvU WVS@$Ћ+E ++*EjC@P EuC@Phvh5 jC@PSu~' 9u~ U)+uF9}}+]])C|t5 SV5q 5$B mjjSVuu5 W5q 5$B w <=tu5hoh jjSVWu5$B  ǃ=t5hhH u1=~u5hh h$u.=~u5hh h -v=~uW5hh h $#=tSV5hh 5$B e[^_ÉUWVS@$Ћ((((@ ЉjC@P ƋC@PSV@%hV B t%Vhhh 4=~Vhh h#b#5We[^_ÐUVS@$Ћ=B t8=t/jC@P ƋC@PSVa$Vh!5B  h#"e[^ÍvUl'=B totfh-h!5B  h6h!5B  hjh!5B  $5B  hh!h] Ívh#2"UVShpj =LucjjjjCC FF VSjt S tV L h !e[^ÍvUhpj ÍvUS7&Å} h o!j أ]ÐUÐU(WVS} u@EPhTj4]ShTj$fEUUEShTj$L9HuwhLP=t/jd )ÃjPSjPhjH u319=H~)uVhTjbj[ v@9HjL}t =H8uEPhTje[^_UÍvUÍvUÍvUÍvUVS]u {u @vjC@PuC@Phvhj C@PS6!e[^U0$+$&$!$@ jPÍvU@WVS@$ЋE@$Ћ8#E@$ЉE@ ЉEEEEjuEPukhuu huuuhuouYhuSu==~hh}t u h ujuFEPW}u hdtuEPM1iLuG}}~EjuFVEuVhvhjEEPh,uǃ uzuQ}v}uuu:=~uhh hv}}uhhdth;uxh>uuhP1EhDu^uh EhKu:uhE1҃}E9~NMԋ@ 9Eu1 MЅtQEMԋ@ EtEԋM9 ub=~uhRhK }t u*}t u}t uh$}}uh{*uh}uhtsuht_=~hhw}t uV}t uE}t u4hPuh}stuh_$EPkNjuMMȍEPW]MMătuEj}t u}t u}uMȉ Puh}hP^PVǃ u!Vhh-jFh"PuIǃ u#uhhj?1juhhhAjjkjj`EVh,Suh,u(juSEPP=~ uSuhh\jujjh0h!S'uSujSj@uj6}t u}t uSvuuEЃuo=~uhKhjE}t u}t up}t u_hF{udEPum} }t/}t umM @ =~hgh}t u}t u}t uhxvOu}t EHuuuNǃ ul=~uuhh6jO}t u}t u}t uh~(OMQu!ƍ^uuS~juF}uluhhz }t uY}t uH}t u7hS u}v }}u E0}HEuuuǃ uuhhj}t u}t u}t uxh_uhhb }t uA}t u0}t uh>}t u}t u}t uuuF e[^_ÉUSM] =c~==~#jchhhAhhsV#19~<@ t@9t @  @ ]ÉUvu ÍvhhhÐUhhhhhUÍvUÍvUÐU@)‰U@|)‰U@)‰ЋÉU@|)‰ЋÉU@ U@U@U@)‰U )hÐU@)‰U@)‰U@)‰UÐUWVS@$Љ@$Љ‹HMJMXrCPjEFPjSuuVuW(TÅ}2hhhhhhjvuHjWuhhhhh_ hhhHj1EP9t} 8 tՐe[^_UU <MI D@ÉUWVuu } t h19e^_ÐU1ÐUÍvUÍvUÍvUÍvUÍvUÍvUÍvUÍvUÍvUÍvUÍvUÐUWVS]xuPBE1EU Mx1EB1B1EByx1EBIx1NjUUЙ;T95PTu9ruu z MPTPue[^_ÉUWVSu}xu jwVWu V =PtpV ¡PML S_ @PV ‹BZZ) TMHx Wu Pe[^_ÐUWVSu Suo lj_SjGPwe[^_ÐUU E9~ÍvUU E9}ÐUÍvUhu h 1@c~ÐUS1ۉ<tPCc~5]UVSu"1<t:@c~FPÃu hM 3)5Ce[^ÍvUVSMt611Y<u@c~Q5e[^ÍvUVSUu u1Eu V&4FPR*Ãu h 3؍e[^ÐUS]E9E } P3]ÐUVSuu VÃt VjS؍e[^ÍvUWVSu] S~SVW(e[^_ÉUEÐUEU ЍÉUWVS]u sSP%NjPSW w wjW e[^_UVSM] U)ڃyu.1DJxBv@Jy*v1D؋I JxHJye[^ÉUWVS}u%t_Kx6 KyWe[^_ÉUWVS]hSEC{u= t}?M\HxMNKHy6v;\M }tHxHyEe[^_ÐUh\j1h+ ÐUh\jÉUÍvURP$ÐUExt @ÍvÐUExt @Ð8%ÍvUSE] xu{u9~vHUM}u]KUM}u]U3UyU9U9}}UME]E]UM1U9U u U9Uv]USE] xu{u9BvHUM}u]KUM}u]1U9Uu U9Uu@]UUE BUUE BUEU MHf@u@ËPu8u h'ÐUUztNz|9B|"u<9vá9B| u%9w}E EmmBÐUWVS]u fCf%2)3;@!‰uttpH uaC\v S@!‰S3utC% ?CvCe[^_ÍvUSU] B CfSff*SpjSS]ÐUSU] B CfSff*#S0{}+jSS[]ÉUVS]M u{uDyu*3x3xFKvV$ VAPR$%yuV$ vVAPRCPRe[^ÐUVSEM uyuLxu2+3y3xFZvVR$$(VR$$#IxuVQR$ VQRPRQIe[^ÉUVS]M u{u@yu2}؋}= jFY  yu  fFuFvF u>u he[^ÐUWVSu] }{u;tfD@u h y~u8{u*ș;E9uEG[v>>{u33fGuGvG u?u he[^_UWVSuM }yu`u h ~u3șEË6)Ɖ1yMuuVW JvWuS$$(~uWuAPR$WuAPRFPRme[^_ÐUX \ļBÍvUUEEfBuBÍvB u:u hÉUWVS]}E}fCuC"Su;u h{tEs3SS9\| u9Xw hK1sSSv{u E E ]fEuEE!Uu}u h}uU}t hUM OfGuG9Wu+?u&hWE$U MRQ_e[^_ÍvUUEEz}E9EvJM) M)JÐUS]CPqX]ÍvUWVS} U29z} hR>u G9Fr4WWvkKSFQPR V_U؍e[^_UWVS}u 9w} hR{;uF9CrvV.S7e[^_ÉUEu =tPÍvUVSu] C9F} hR6e[^ÉUVSu] 6e[^ÍvUVS] uVu,pVSPe[^ÍvUWU 0HPRu}ÐUWVS}] u9s}CsPWoC8CVPWYD7e[^_UWVSu] L|)C9F~!AAAHSVIECPV<ECPV/ǍCPV#EUЉȍe[^_ÉUUE |9B1ÉDÐUS=tЃ;u]ÍvUÐUS[ÇB]]unimplemented bif-c/bin/sh-chain_argsTRUtruTMPDIR/tmp%.*s/Chain_XXXXXX%.*s %s -b -o %sI/O error during CHAIN.%d%.2d%.2dY@zDuncaught exception-TBPATHBad shared file display numberbogus next_env argument %ldread_ln_tab bugrThis application contains no bcode.OS2MagicCouldn't allocate program pointer.Usage: %s [-g] [-0 ] [] DUP %d frame header size errormagic_suffix_for_BSDposition = %d, progsize = %d B-code format error.?????@yr??A %s Aillegal opshared stack errorstack frame errorTrue BASIC Graphics OutputTrue BASIC*Bad value in sys_font. Contact True BASIC. font name too long (max 100).%s: %s 9x15%s: font size too large (limit 1000). %s: bad font style (max length 25). romanitalicobliqueboldmediumRoman%s%s, %sItalicOblique%s: full font name- %s *%s-%s%s-%s%s%s-*-%d* New font name: %s %s: Cannot load font: %s Server failed to allocate request for %d blocks of memory. DirectColorTrueColorPseudoColorStaticColorGrayScaleStaticGrayTrue BASICX%s: cannot connect to X server %s %s: Window manager didn't set icon sizes - using default. %s: structure allocation for windowName failed. %s: structure allocation for iconName failed. %s: MappingNotify event; refreshing keyboard mapping. %s: DestroyNotify event; window has been destroyed! %s: ColormapNotify event; colormap has changed! %s: input buffer full. Too Small%s: window too small. Minimum width %d, height %d. %s: window too big. Maximum width %d, height %d. Can't switch to singlebuffer mode from doublebuffer mode.%s Can't switch to doublebuffer mode from singlebuffer mode.%s: doublebuffer not implemented for X Windows. %s: can't use dynamic color mode on a visual of class: %s %s: can't allocate colors on visual of class: %s %s: couldn't allocate read/write colors. %s: requested color %d allocated as read/write color %d. %s: private color map not useful on visual class %s. %s: couldn't create a private colormap. %s: couldn't get a visual at the default depth and class %s. %s: using visual that was found. %s: created a private colormap. %s: harware colormap is immutable: cannot create new colormap. %s: installing new colormap for window. StaticGray color mode, Maxcolor is %d. %s: found a %s class visual at default depth. %s: colormap size %d, bits per rgb %d, depth %d No PseudoColor visual at default depth, Maxcolor is %d. %s: %s class visual at default depth is not default visual! whiteYellowmagentaredcyangreenbluedim grayWhiteBrownMagentaRedCyanGreenBlueBlack%s: color name %s not in database%s: the RGB values from the True BASIC database are %d, %d, %d %s: the RGB values from the Xlib database are %d, %d, %d %s: can't allocate color: %s All color cells allocated and no matching cell found. %s: the RGB values actually allocated are %d, %d, %d %s: allocated %d read-only color cells %s: allocated %d read/write color cells %s: using standard colormap. %s: no standard colormap available. %s: using default colormap. %s: no default colormap available. %s: couldn't create colormap. %s: RGB_BEST_MAP colormap property not set. %s: RGB_BEST_MAP colormap property is set but is missing data. %s: Standard colormap property is set but is missing data. %s: harware colormap is immutable: cannot create new colomap. %s: can't allocate X color names on a StaticGray class visual. %s: color name %s not in database. %s: color name %s not found. %s: can't allocate color: %s: color number %d has not been allocated. %s: color number must be greater than 0. %s: color number %d is greater than maxcolor %d. %s: couldn't allocate read-only color %d with RGB mix %d, %d, %d %s: try using dynamic mode to create more read-write colors %s: color %d has not been allocated. %s: system failed to get default mix for color: %d %s: the color %d is greater than the maxcolor %d! %s: the color %d is less than 0! %s: the color %d has not been allocated. %s: allocated read-only color %d %s: using color mix for white as default. %s: couldn't set color %d %s: try dynamic mode for more read-write colors. 1%d%s: pointer is in another window. Arguments for TW_WSET_CURRENT must be between 0 and 1. Arguments for TW_WSET_CURRENT must have max greater than min. Arguments for TW_WSET_MINMAX must be between 0 and 1. Arguments for TW_WSET_MINMAX must have max greater than min. get colormap sizeget colormap offsetget x widget gl widget pipe inget pipe outget display widthget display heightget envset envStat for setting [%s]: %d set pipe idset resizeset rescaleset width resize incset height resize incset box keepInvalid header for BOX KEEP free pixmap. set linewidthset linestyleset deleteset icon nameset ctrl-cset immuneset highlightset blocking offError: couldn't disable blocking for pipe process (%d). Can't turn blocking off for stdin, stdout, stderr. Bad WINFO argument: %s %ldbad value passed to sys mat plot %s: popup not implemented for X version. %tWarning: percent (%) symbol in menu string ignored.%s: bad value for resize: %d Current window dimensions do not fit proposed minmax. window dimensions: %d %d proposed minmax: %d %d %d %d %s: bad value for rescale: %d Gshade not implemented for X version. clear0andandreverse2copy3andinverted4dst5xor6or7nor8equiv9invert10orreverse11copyinverted12orinverted13nand14set15progname: unknown option for drawmode (%s). Invalid header from BOX SHOW string. %s: depth for image (%d) does not match default depth (%d) TBX: server failed to allocate 14 blocks of memory. -misc-fixed-medium-r-normal--15-*-90-*fixed%s: Cannot open %s font %s: using %s font values for ReadPixel not in range for window.p@o@ %s: reading bitmap file %s... %s: done reading bitmap file. %s: couldn't open file %s %s: invalid bitmap file %s %s: insufficient working storage for bitmap file %s %s: image size read %d %d %s: writing bitmap file %s... %s: done writing bitmap file. %s: error %d writing to file %s %s: image size written %d %d wSending PostScript output to: %s%s Couldn't open file: %s showpagegrestore % restore graphics state% --- End True BASIC PostScript Output --- PostScript output done.openclosereadwriteOptions for PIPE are: open,close,read,write. Can't open a pipe for fid %d. Must pass a file number to close a pipe. -1stdinstdoutstderrNo pipe associated with file number %d. rrwrwpassOpen pipe values are: r, w, rw, rwpass. error in dup2 for stdin: %d error in dup2 for stdout: %d -c/bin/shPIPE OPEN failed with rwpass option: %s %s %s Error: %s Error: couldn`t open pipe.Couldn't open pipe for %s. To close a pipe, you must pass the file number. Error reading from %s (fn: %d). Pipe not opened for reading: %s Error writing to %s (fn: %d). Pipe not opened for writing: %s Too many pipe channels open. Limit %d Couldn't save file structure pointer. Parameter for DIAGNOSTICS must be 0, 1, or 2. %s for %s %s Error: attempt to fork failed.%s Error occurred in unlinked CCALL.chookError: execl failed to CHOOK.Make sure CHOOK is in your PATH.version error\t l\ 4|dPTtdplH$p`@@@@t@@  ,@@ Pd@@@ p@<  @P@@@@$@@@@@ T55 y5@6P6F MTN,L@@@O}@ħ@@ 4\@@@@@̨@@,h@@@ܢPdخ@x@D@|@P@@t@@vP,S0 0@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@p@@@@Ա@Dx@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@8l@Ph@@@@@@@t@@@@@@@@@@@@@@@H@@@@ЪPlī<x@@@l@@@@@@@@@@@@@@@@@L@@@@@@@@@@@@@@@@@@@ WW8X,X XDX4@@l@@@@@@@@@@PXX[X\@@`(CdE@@@@T`0_@@e@@|gg@h@ @@@@@@@@@@q@Tk@@@@@@m@@p@@@T@ @ @@@@@@@@@@@@@@@@@@@@@@@@@@     UUUUUUUUUUUUUUUUUUUUUUUUUU#.ռɼdUUUU @(#)True BASIC X11R6 for RedHat 5.0 Release Dated 02-16-98@(#)Linux RedHat 5.0@(#)Copyright (c) 1998 by True BASIC, Inc. All rights reserved.  @Ihfij{C|D^OPQRSTUVWXFGH`abcdefghijklmnopqrstuvwxymnOQMobp` BuvAE@BDFHb[ACEGIJLNPRTVXZ\^`cegijklmnqtwz}~JK,Hdx,BUX@A}:W:Q@-(;^ 9^;O ;#B ;ҶOɃ;C]r2:0yE>Hz>ư>h㈵>-C6?MbP?{Gz???$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDJ-DyCxD(,* E496Magic™ҙ"2BRbršҚ"2BRbr›қ"2BRbrœҜ"2BRbrҝ"2BRbržҞ"2BRbrŸҟ"2BRbr Ҡ"2BRbr¡t @ @T 3 (0GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.3GCC: (GNU) 2.7.2.301.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.hash.dynsym.dynstr.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.ctors.dtors.got.dynamic.bss.comment.noteԀ#l) TT` 139 B (K ( T@@,Zll`_̡!te@@8k\\8s@@Uyjjj$lmD1mpp@sBUXlp La  +s2 Zz ^ L a v (" )e T r  kg$uP"s I\ _ | px   K]mgA'1 a[2e9 3aR#G 7  V N 2b | ~)nt ( u -XIO7 D  V2`u ^s  BX Q  9        : a '  N  ?   NSEOUTINNEWBYTE,.INPUTOUTPUTNETINNETOUTNETWORKNEWOLDOLDPRINTER{}RECORDRANDOMSTREAMTEXT/tmp/tempBEGINENDSAMENEXTWINDOWMIDDLEDISPLAYINTERNALNONENUMERICSTRINGUNKNOWNYESNOFILEDEVICExsizewidthysizexoriglbearingheightascentdescent fixed_width monospaceleftmiddleright moveto:/cmtrx matrix currentmatrix def % save current transform=tbmtrx setmatrix % set to unscaled transform() showAcmtrx setmatrix % set back to current transformSystem error - margin <= 0&newpath % box lines  lineto closepathstroke % scale aspect ratio for ellipsegsave scalenewpath 0 360 arc1grestore % restore from ellipse&newpath % box clear%newpath % box areafill% restore foreground colorstreamABCD"newpath % clear 303232332323- in LEFTBASE.newpath % plot, turn beam on;C -13013 Invalid argument for CLIPBOARD. -13012 Scrollbar size plus position is not within the range 0 to 1. -13011 No horizontal scroll bar for window. -13010 No vertical scroll bar for window. -13009 Output window bounds must be 0 to 1. -13008 Output window minimum >= maximum. -13007 Invalid argument for TW_WSCROLL. -13006 Canvas bounds must be 0 to 1. -13005 Canvas minimum >= maximum. -13004 Too many windows open. -13003 True Windows already intialized. -13002 Illegal window number. -13001 True Windows not initialized -13000 True Windows not available with this version -12022 Invalid argument for WINFO. -12021 Invalid argument for DRAWMODE. -12020 Error writing to file for WRITEIMAGE. -12019 Insufficient storage for WRITEIMAGE file. -12018 Couldn't open file for WRITEIMAGE. -12017 PIPE not opened for WRITING. -12016 WRITE PIPE operation failed. -12015 PIPE not opened for READING. -12014 READ PIPE operation failed. -12013 Argument to CLOSE a PIPE must be a file number. -12012 Too many PIPEs open. -12011 OPEN PIPE operation failed. -12010 Invalid read/write permission for OPEN PIPE. -12009 No PIPE associated with file number. -12008 Argument to OPEN a PIPE must be a string. -12007 Invalid argument for PIPE. -12006 PostScript window size must be > 0. -12005 Window size required for POSTSCRIPT ONLY mode ("xpixels|ypixels"). -12004 Invalid argument for FONTINFO. -12003 SET LINEWIDTH and SET LINESTYLE arguments must convert to a number. -12002 Font size must be > 0. -12001 Array of vertices must have two dimensions for Gourard shading. -12000 Number of colors does not match number of vertices for Gourard shading. -11500 Unspecified interpreter system error. -11301 Unknown or invalid dialog box specification. -11300 Dialog box has no buttons specified. -11273 Not enough values for attribute list in SET/GET. -11272 No Help File opened. -11271 RECTANGLE minimum = maximum. -11270 Can't get STAT info for file in directory. -11269 Unknown option for SUB System. -11268 Can't get current directory. -11267 Unknown or invalid directory. -11266 Unknown or invalid pen pattern. -11265 Unknown or invalid brush pattern. -11264 Can't SELECT an unSHOWn window. -11263 Menu parent incorrect for menu type. -11262 Can't make menubar item a separator. -11261 Can't check a menubar item. -11260 Unknown or invalid group object type. -11259 Unknown or invalid window object type. -11258 Unknown or invalid graphic object type. -11257 Unknown or invalid control object type. -11256 Menu separators are not checkable. -11255 Can't check a menu separator. -11254 Unknown or invalid menu item type specification. -11253 Line out of range for GET LINE. -11252 Paragraph out of range for GET LINE. -11251 Color must be >= 0. -11250 Too many trap chars for TextEdit. -11249 Can't set FONT METRICS. -11248 Can't set MAX WIDTH. -11247 Can't set LINE. -11246 Can't set LINES IN PAR. -11245 Can't set NUM CHARS. -11244 Can't set NUM PARS. -11243 Can't set NUM LINES. -11242 Can't set ACTIVE until object is visible. -11241 Too many EXIT CHARS for Edit Field. -11240 Unknown or invalid object type specification in CREATE. -11239 Unable to SHOW window. -11238 Unknown object method. -11237 Unknown window method. -11236 Object ID out of range. -11235 Error appending paragraph. -11234 Error deleting paragraph. -11233 Paragraph number is too large. -11232 Error adding paragraph. -11229 TextEdit method passed to non-TextEdit object. -11228 Font size must be greater than zero. -11227 Unknown or invalid font style. -11226 Unknown or invalid font name. -11225 Unknown or invalid attribute in SET/GET. -11224 Unknown or invalid group method. -11223 Attribute not used for specified object. -11222 Unknown or invalid SYS_INFO request. -11221 Cannot reference a freed object ID. -11220 Unknown or invalid object ID. -11215 Error putting text onto clipboard. -11214 Error opening clipboard for writing. -11213 Error closing clipboard. -11212 Error opening clipboard for reading. -11211 Invalid type for SUB Clipboard. -11210 Invalid option for SUB Clipboard. -11009 User-defined window coordinates too large for GET MOUSE (POINT). -11008 No such color. -11005 Channel isn't a window. -11003 Screen bounds must be 0 to 1. -11002 Screen minimum >= maximum. -11001 Window minimum = maximum. -11000 Can't do graphics on this computer. -10100 Function not available in this version. -10006 Exception in CHAINed program. -8503 Can't use READ or WRITE for TEXT file. -8502 Must be RECORD or BYTE file. -8501 Must be a TEXT file. -8450 Nested INPUT statements with TIMEOUT clauses. -8304 Must SET RECSIZE before WRITE. -8104 Data item isn't a string. -7351 Must be BYTE file for READ BYTES. -7252 File pointer out of bounds. -7251 Must be BYTE file or empty for SET RECSIZE. -7250 Can't SET RECSIZE on non-empty RECORD file. -4501 Error in PLAY string. -4303 Invalid numeric argument "#". -4020 Improper NUM string. -3051 Argument too large or small for accurate result. -3050 Argument for SIN, COS, or TAN too large. -3000 Argument not in range. -963 Illegal selector in comopen or comlib. -961 Unknown communications status type. -960 Unknown communications option. -702 lines compiled. -701 Cancelled. -700 (Press to cancel) -699 Application name: -698 Run|Compile|Bind|Cancel -697 Choose an action: -696 True BASIC Language System -695 True BASIC Compiled File: -694 True BASIC Source: -693 Laying out... -692 Linking... -691 Organizing output... -690 Writing output to: -689 Usage: -688 No output written. -687 This version of True BASIC will only read compiled True BASIC files. -686 Illegal file type. -685 EDT CMD FND MRK CP MV UNDO BKPT RUN HELP -684 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 -683 # is not a STOREd workspace. -682 RESTORE from which file? -681 STORE to which file? -680 restored -679 stored -678 Get mouse options are left, middle, right -677 CHAIN command not supported for Sampler version -676 Sampler version allows only 150 lines -675 Please try "TO line-number". -674 800/TRBASIC or write to us at: -673 length. To order the standard version call -672 saved if they are 250 lines of code or fewer in -671 any size. New programs that you create can be -670 System is designed to open and run programs of -669 This Student Version of the True BASIC Language -668 at line -667 Must be compiled. -666 Must invoke with CHAIN to pass array argument other than command line. -665 Must be a program name -664 Maximum string length declaration # too long. -663 Out of memory - program variables freed to create space. -662 Not enough room to display split banner. -661 Must be an integer -660 Incorrect version of RTP -659 Library -658 Bound output is in file -657 at line -656 in file -655 Can't CHAIN, DO, or HELLO with a .EXE file. -654 Subroutine -653 Main program -652 Rebound String -651 Key -650 West Lebanon, NH 03784 -649 12 Commerce Avenue -648 True BASIC, Inc. -647 to purchase a standard version, or write us at: -646 Please call True BASIC, Inc. (800/TR-BASIC) -645 Sampler version allows only 150 lines. -644 #5| Options|Toggle FKey Display|Split at...|Hide Menus|Clock On|@|Double-Click Speed|Scroll Speed| -643 Try SPLIT 0 up to SPLIT 23. -642 Try SPLIT 6 up to SPLIT 23. -641 #5| Options|Split at...|Hide Menus|Clock On|@|Double-Click Speed|Scroll Speed| -640 #5| Options|Split at...|Hide Menus|Clock Off|@|Double-Click Speed|Scroll Speed| -639 Please try "files,length" -638 Not found. Search from start of file? -637 EDIT CMD FIND MARK COPY MOVE UNDEL BRKPT RUN HELP -636 Please try "# directory". -635 Ok -634 Open -633 Switch -632 File not available for switching. -631 Undefined handler -630 Warning: constant %n will overflow. -629 #5| Options|Toggle FKey Display|Split at...|Hide Menus|Clock Off|@|Double-Click Speed|Scroll Speed| -628 #4| Run|Run@R|Continue|Breakpoint@B|Compile@T|Bind@A| -627 #3| Custom|Load|Forget|Store Workspace...|Restore Workspace...|@|Script|@|Do|Do Format@D|Do Trace| -626 #2| Edit|Cut@X|Copy@C|Paste@V|@|Find@F|Find Again@G|Change@E|@|Keep@K|Include|@|Edit|Select|Move To@Y| -625 #1| File|New@N|Open@O|Switch@L|Close@W|@|Save@S|Save As@Z|Unsave@H|@|Print@P|@|Quit@Q| -624 F1-EDIT F2-CMD F3-FIND F4-MARK F5-COPY F6-MOVE F7-UNDEL F8-BRKPT F9-RUN F10-HELP -623 Try "Load lib, lib...". -622 Program unit too large: -621 Constant too large: -620 Too many shared channels -619 You have two public variables called -618 You have two routines called -617 Illegal array bounds for -616 Undefined public variable -615 Undefined routine -614 Type is wrong for -613 No main program. -612 Illegal statement: need LET for assignment, or try the NOLET command -611 Program unit too large -610 Unknown variable -609 Must be an array -608 Illegal file -607 Illegal keyword -606 Name can't be redefined -605 Illegal parameter -604 Missing end statement -603 Expected a relational operator -602 Must be a string constant -601 Illegal exit -600 This must first appear in a DIM or DECLARE DEF -599 Must be a function name -598 Must be a picture name -597 Must be a subroutine name -596 Must be a number -595 Illegal option -594 Expected " -593 Must be a variable -592 Wrong type -591 Illegal data -590 Ending doesn't match beginning -589 Illegal number -588 Illegal line number -587 Can't use this statement here -586 Illegal statement -585 Doesn't belong here -584 Statement outside of program -583 Wrong number of dimensions -582 Argument types don't match -581 Wrong number of arguments -580 Illegal expression -579 Doesn't belong here -578 Type SPLIT to see a menu of the function keys -577 Please reenter input line. -576 Illegal JIS number -575 Illegal Shift-JIS number -574 KCHR$ argument must be between 0 and 65535 -573 Directory -572 lines -571 Stopped at line -570 Editing -569 Free memory -568 File size -567 called at -566 At line -565 in -564 Cancel -563 No -562 Yes -561 Untitled -560 bytes -559 Stands for -558 changes -557 Can't chain from old compiled program. -556 Can't chain from bound program. -555 System error. -115 Choose scroll rate. -114 Not a color file. -113 Switch to which file? -112 Close which file? -111 Current file -110 Currently: -109 Choose double-click rate. -108 Slow -107 Middling -106 Speedy -105 Use this directory -104 Change drives -103 UNSAVE which file? -102 Use which SCRIPT file? -101 Save your program as: -100 OPEN which file? -99 LOAD which file? -98 Use what INCLUDE file? -97 Use what DO file? -96 put back -95 line -94 cut to clipboard -93 copied to clipboard -92 moved -91 copied -90 saved -89 byte -88 marked -87 listed -86 kept -85 included -84 deleted -83 compiled -82 made -81 change -80 whole file -79 editing region -78 marked region -77 witch, pen, ancel : -76 Switch to it? -75 Split at what line? -74 Select what block of lines|or subroutine? -73 Move to what line? -72 Edit what block of lines or subroutine? -71 Change to? -70 Change from? -69 Breakpoint at what line? -68 Please name the current file. -67 Rename the file being opened. -66 has been opened. -65 A file named -64 Change to which drive? -62 You must be in the SOURCE window to CUT, COPY (to clipboard), or PASTE. -61 Error reading from clipboard: -60 You have already opened a file named -59 Now editing -58 Echo turned off. -57 Echoing to -56 Switching has been disabled. Please type SWITCH to re-enable. -55 Switching has been enabled. -54 No file name given for -53 No line given for -52 Menus hidden. Type MENUS to reshow. -51 No files available for switching. -50 may not have been removed. -49 You may be left in the current directory. -48 Trouble accessing directory -47 Closing all switched files. -46 The MODE command may be used only when menus are hidden -45 Error creating temporary file. -44 No files present in this directory. -43 is already open. Please try another name. -42 No lines selected. -41 Please try "COLORS TO filename" or "COLORS FROM filename". -40 No saved copy--Still want to compile? -39 Try SPLIT 0 up to SPLIT 24. -38 Usage error. -37 Please try "RENAME new" or "RENAME old,new". -36 Please try "ECHO" or "ECHO TO filename" or "ECHO OFF". -35 Please try "SCRIPT filename, arg, arg...". -34 Do you want to create it? -33 Do you want to overwrite it? -32 Sorry, can't find HELP files. -31 Keep only the selected lines? -30 Do you want to save this file? -29 Define it as: -28 Press key to redefine: -27 Help: -26 Find: -25 Program stopped. -24 Breakpoint. -23 Can't continue. -22 Change? -21 (Compiled program.) -20 Can't edit compiled program. -19 No saved copy--Save before compiling? -18 Can't change that key. -17 Bad FIND item; try using quotes. -16 Please try "LOCATE item". -15 Please try "CHANGE(TRY) old, new". -14 Try SPLIT 6 up to SPLIT 24. -13 Press any key to continue. -12 Can't help with that. Try HELP TOPICS. -11 Can't copy region into itself. -10 Please try "KEY" or "KEY FROM file" or "KEY TO file". -9 Please try "SAVE filename" or "REPLACE filename". -8 Please say what lines you mean. -7 Not found. -6 No such function or subroutine. -5 No such line numbers. -4 Please type line numbers as 100 or 100-150. -3 Please try "# filename". -2 The # command is just "#". -1 What? (Please type HELP.) 1001 Overflow in numeric constant. 1002 Overflow. 1003 Overflow in numeric function. 1004 Overflow in VAL. 1005 Overflow in MAT operation. 1006 Overflow in READ. 1007 Overflow in INPUT. 1008 Overflow in file INPUT. 1009 Overflow in DET or DOT. 1051 String too long. 1052 String too long in MAT. 1053 String too long in READ. 1054 String too long in INPUT. 1105 String too long in file INPUT. 1106 String too long in assignment. 2001 Subscript out of bounds. 3001 Division by zero. 3002 Negative number to non-integral power. 3003 Zero to negative power. 3004 LOG of number <= 0. 3005 SQR of negative number. 3006 MOD and REMAINDER can't have 0 as 2nd argument. 3007 ASIN or ACOS argument must be between 1 and -1. 3008 Can't use ANGLE(0,0). 3009 Can't invert singular matrix. 4001 VAL string isn't a proper number. 4002 CHR$ argument must be between 0 and 255. 4003 Improper ORD string. 4004 SIZE index out of range. 4005 TAB column less than 1. 4006 MARGIN less than zonewidth. 4007 ZONEWIDTH out of range. 4008 LBOUND index out of range. 4009 UBOUND index out of range. 4010 REPEAT$ count < 0. 4102 Improper TEXT JUSTIFY value. 4301 Mismatched parameters for CHAIN/PROGRAM. 4302 Mismatched dimensions for CHAIN/PROGRAM. 5000 Out of memory. 5001 Array too large. 6001 Mismatched array sizes. 6002 DET needs a square matrix. 6003 INV needs a square matrix. 6004 IDN must make a square matrix. 6005 Illegal array bounds. 6101 Mismatched array sizes. 6401 Must have two or more columns for MAT PLOT. 7001 Channel number must be 1 to 1000. 7002 Can't use #0 here. 7003 Channel is already open. 7004 Channel isn't open. 7051 Record LENGTH <= 0. 7100 Unknown value for OPEN option. 7102 Too many channels open. 7103 File's record size doesn't match OPEN RECSIZE. 7104 Wrong type of file. 7105 Wrong type of file for LOCK (UNLOCK). 7106 Wrong type of file for NETWORK (NETOUT, NETIN) access. 7107 Can't UNLOCK range. 7108 Range or part of range is already LOCKed. 7202 Must be RECORD or BYTE file for SET RECORD. 7204 Can't use SAME here. 7301 Can't ERASE file not opened as OUTIN. 7302 Can't output to INPUT file. 7303 Can't input from OUTPUT file. 7308 Can't PRINT or WRITE to middle of this file. 7312 Can't set ZONEWIDTH or MARGIN for this file. 7313 Can't set ZONEWIDTH or MARGIN for INPUT file. 7317 Can't PRINT to INTERNAL file. 7318 Can't INPUT from INTERNAL file. 7321 Can't SKIP REST on STREAM file. 7401 Channel is not open for TRACE. 7402 Wrong file type for TRACE. 8001 Reading past end of data. 8002 Too few input items. 8003 Too many input items. 8011 Reading past end of file. 8012 Too few data in record. 8013 Too many data in record. 8101 Data item isn't a number. 8102 Badly formed input line. 8103 String given instead of number. 8105 Badly formed input line from file. 8201 Badly formed USING string. 8202 No USING item for output. 8203 USING value too large for field. 8204 USING exponent too large for field. 8301 Output item bigger than RECSIZE. 8302 Input item bigger than RECSIZE. 8401 Input timeout. 8402 TIMEOUT value < 0. 9000 File i/o error. 9001 File is read or write protected. 9002 Trouble using disk or printer. 9003 No such file. 9004 File already exists. 9005 Diskette removed, or wrong diskette. 9006 Disk full. 9007 Too many channels open. 9008 No such directory. 9100 Can't open temporary file. 9101 Can't open PRINTER. 9200 File i/o error (PostScript). 9201 File is read or write protected (PostScript). 9202 Trouble using disk or printer (PostScript). 9203 No such file (PostScript). 9204 File already exists (PostScript). 9205 Diskette removed, or wrong diskette (PostScript). 9206 Disk full (PostScript). 9207 Too many channels open (PostScript). 9208 No such directory (PostScript). 9209 Illegal PostScript area definition. 9210 PostScript journalling already enabled. 9211 Couldn't open file with write permission (PostScript). 9212 PostScript journalling not enabled. 9601 Cursor set out of bounds. 10001 ON index out of range, no ELSE given. 10002 RETURN without GOSUB. 10004 No CASE selected, but no CASE ELSE. 10005 Program not available for CHAIN. 11004 Can't SET WINDOW in picture. 11140 No GET MOUSE on this computer. lcalcz nul soh stx etx eot enq ack bel bs ht lf vt ff cr so si dle dc1 dc2 dc3 dc4 nak syn etb can em sub esc fs gs rs us sp und gra lbr vln rbr til del )newpath % plot a point% calc xstart in user space () stringwidth pop div4 mul 2 div sub % leave xstart on stack. moveto % justify text bottom0 moveto % justify text baseline0 moveto % text justify halfline/ moveto % text justify top/cap% plot the text'% default text mode foreground is black'% default text mode background is white setrgbcolor%!PS-Adobe-2.0 EPSF-2.0%%BoundingBox: %%%Title: True BASIC PostScript Output%%%Creator: True BASIC Language System%%CreationDate:  %%EndComments6gsave % save preTB graphics state;/truebasicdict 2 dict def % define local dictionary;/tbmtrx matrix currentmatrix def % save unscaled transform@truebasicdict begin % start using local dictionary0 translate % move coordinate system setlinewidth4grestore % restore original window0gsave % entering new window@ translate % translate to new origin for sub window0 scale % scale output to new window+ scale % new transformation0 translate % translate to new window origin0newpath % new clipping regionclip8end % done using local dictionary/grestore % restore old window)% set-up default font and character sizes/Courier findfont scalefont setfont'% set user-specified font for plot text/ findfont12 scalefont setfont % set window or screen statement"CENTERRIGHTTOPCAPHALFBOTTOM0.0000000ee+:99:99:99 #%*.$+-<>#%* #%*.,$+-^ #%*.,$+-^<><><*#^$-+><$-+#%*.#%*,$#%*., 0*$$+$-1., 0123456789GRAPHICS DOUBLEBUFFERDYNAMICRGBCMAPB/WCOLOR7grestore % restore from flled ellipseI,BLACK,0,BLUE,1,GREEN,2,CYAN,3,RED,4,MAGENTA,5,BROWN,6,WHITE,7,YELLOW,14,BLACKWHITEwhiteblack BACKGROUNDBLINKOFFON1 ONLY INVALID MODE set linestyle set linewidthpostscript only|postscript xsizepostscript ysize [] 0 setdash[4 4] setdash brush pattern brush color pen colorcursor grab cursorenvException caused. ( occurred at line  called from line  Main programError closing channels.  -chain_argsInvalid B-code file.oa/.'The d'Arbeloff Interactive Math ProjectEuler's Method-adobe-courier-normalmedium-r-normal--bold-r-normal--*"Euler's Method","","This tool supports visual exploration of Euler's method of approximating solutions to the first order ODE, dy/dt = f(t,y).","Roll the mouse cursor over the main window to display the direction vector determined by f(t,y), the coordinates (t,y), and the slope f(t,y).","","Click the pop-up menu button [v] to open the list of equations. Click an equation to select it.","Click the 'Slope Field' checkbox to toggle the slope field on or off.","Click the mouse on the (t,y) plane to set initial values for numerical solutions on the graph plane and in the coordinate list.","Click one of the numerical methods to select Euler step sizes or the solution.","-Selecting an Euler method allows you to build a solution by hand by setting a sequence of vectors. Click the plane to set a vector, then click near the head of the vector to build the Euler solution.","-You can also build a solution by clicking [Start]; or by clicking the plane, clicking [Start], and then clicking [Next Step] over and over.","-Selecting the 'Actual' checkbox, then [Start] allows you do draw a solution for comparison.","Click [All Euler] and then click [Start] or click the plane to compare the four Euler approximations.","Click [Clear] to remove vectors and solutions from the plane.","Click [Start] to set a vector or start a solution from the current initial values.","Click [Next Step] to set the next Euler vector in a numerical solution you have started.","t","y",22,22,"2y + 1","t - y^[2]","y^[2] - 2y + 1","sin(y)","y","sin(t)","y sin(t)","y - t","y^[2] - t","-ty","Euler: 1.00","Euler: 0.50","Euler: 0.25","Euler: 0.125","Actual","All Euler",23,24,25,26,27,21,1,.5,.25,.125,.03125,.5,txybold---%.## f(t,y) =  Slope FieldMethod and Step_[0] =--%.## =f(t,y)ClearStart Next StepboldQuitHelpbold00111100000000000000000000000,01000010000110001100011000100,10011001001001010010100101100,10100001000001010010100100100,10100001000010010010100100100,10011001000100010010100100100,01000010001111001100011001110,00111100000000000000000000000,10001000010001000000010000000000,10001000010001000000010000000000,10001000010001001110010110010110,11111000011111010001011001011001,10001000010001010001010001010001,10001000010001010001010001010001,10001010010001001110010001010001,1boldxy-Continue [------#--%.#normal0.w--%.#----%normal0/2357----%.#------%normal0-w----#--%.#normal0/4/2357-.^_bold]^_bold]bold -%.#######- --%.##### -%.##^^^^00.0,0,1,1,1,1,0,0,0,1,1,1,1,0,0,0,1,1,1,1,1,1,0,1,1,1,1,1,1,0,1,1,0,0,0,1,1,1,1,1,0,0,0,1,1,1,1,0,0,0,0,1,1,1,0,0,0,0,1,1,1,1,0,0,0,1,1,1,1,1,0,0,0,1,1,0,1,1,1,1,1,1,0,1,1,1,1,1,1,0,0,0,1,1,1,1,0,0,0,1,1,1,1,0,0,boldboldboldbold^_bold*bold*bold'0   ??333333??',?<? >2x*UZ7dPNMb@?@(#!??333333????-DT! @ ?@ @?? ?ư>9RFߑ?/#K\' ILMn Xm Z ! ?(#RCXJCBQ[Yd,  c#"Aa!)19AIYi()0189@IPQXY`hHqy?? Z  -DT!?-DT!-DT! @Q?Q@1fAmQz8+?333333?`y?uqts r Rʚ; >GRCcyْ?.?kZ@??` U"#$%&'*+,-/##g%* 'd?@Bʚ; _BvH7BmB@0BقnQ:BTk|\Bygm eu܍qgRJqn 7-4j2D},gC2gFxcTEW`e|AH\v5AHxYFQUz5߼QdȋBN0}GJMraB3GNgmC؅W4vC|FvaJ3:Ft ND*4VQsqUf*4Xx0IΕ2a\_ k_kpc8jfsYH jr-3;nz42q PԣJug^Jp5|xFBY|#u5%< eE./ $,<D\dt| $,<L\l| ,<L\l| ,<L\l| $l$LT$<|,4DL\dt| ,dl|\LdLtLL4M ;$B ,   G  +   ;  $,     ,      <<==>$A $,    ; ,   !0   G  +$Q D $$ , ?  !8 + C #G# + C @A A7G @@@BI   $ + C #G# + C @$ !N !#H ! 8 CC+ C #G# +   nDbCEF Q  7DCI@ 7I @ @q@F @@ @@7W 7  7 @$ 0 + C #G# +! FbG 7M 7  t  E DHC@ F    @(    4 + C G +9CIC&JH%C@ + C G +9JKKF"KCL"X%S CMF N"Y% T 37  CO>/N!CLk  & H &% T &  &$ H  ;" ;P + C G( (+9G7KF"K&CR"XQ&S& CM&F N"YQ T(( (37)()CO=/N!CRj()* (')*Q T()* (')*$J( %P(( ; # ; 8 + C /G/ +H/H$KF"N"H% C%"s% n 37M&3 ' SK 9D ( H% E) C*  ;+ ;4 + C /G/ +/H$KF"N"HH C%"sH n 37 M&3 ' S K  9D  H E) C*  ;, ;  EITCUT CV8 -fe WK.XY0Z  f [ O /C&0C$  ,Db[ T \]\; ; #0 -Po^C^e1a+,A4 KC& l^ C& ^S2  D/_` C 0 aK  BY K K   $ bc!dHeffg hhiljjk345L  ,Db[ C6TCn 7&A'mE (H)) ())/NI(9D9 (( e7 8) 9 ) H!:#; (#7 8) 9 ) ;#( 7#8  )&) &7'A4  &!    C   #     Ya ;m^;Go;;s] ;n^;Go;;CE CN ;m^;TN ;;; ;  ;;  ^ ;n^;#E0GBd ?@??A M? E?BCC="?"="@"= DE   F#   O? DS&TT + F EGF E<EEEmH E +`H E +SHE +FUTTE H_E HUE EHFUTTBFUTTFUTT!X I!"* D E# V"$"% MM e"&MNN Z"MNOO L"MNO''D""F&TTTTWTTTT/EXVuTYEZVkT[EWVaT\E]VWT^E_VMT`EaVCbV" L TLT]LP""M "$""F&TT+ QI Lk"EHVc2JJkI"EHVc2JJ J TLTI G""@J G3JTT dde f g*h+ G(1#E(V#)E+ F TT+ C dI#&TT R)F1Qf # *c#iFK/QC++ F1 dD1 ev,c#iFK0QC-+ F1 dD1 eN.b#iFK6QC/+ F1 dD1 eg0M1QC)U RM+ E1C)RM+ E1C)1gf LR GjT T+ GkT T!K+:f HG4/jR ^Q/Y/G LGKGlT TK4GjT T)IG41-:f HG40jR ^Q0Y0G LGKGlT TK4GjT TM/@+ GkT Tf NBFTT 46_R SQ6N6BFTT 4GjT TGUT ThGmT T  "4  23, n  O? DbS&&& =22o"#E$Fp&&" O# J$ E Fq&&r @ &!2&"2?s@t#"#$$%uvwwx y z&D =B(B)  p()B45   23@ {  d |8A M| E|BCC?|E@8O F| A'|8 C} " F #D" E"*E #u"E"~E#f"1E*#\"/E/#R"0J"6E"C1#$ 9(9 6O*9(9 F#C6#٨input_item#ǡТ̡3Ũinput_lineިlockVadd_lockԨfind_lockQfind_lock_overlapdelete_lock&mark_env2new_channeljnum24$ڨopenàšϢˡƢjơƢ/Ρ!+ɢbadopen2Ҩold_openۨopen_screenŠšϢkopen_temp*١̨openchan?qualVread_head@HX`px80(0 888008000H0808000`000000(08HPX`h0P8h0000p0X08P0`8080P8@880(08`08880088000008p0 0(00080@0H0P0X0`0h0p0x8888x8000000880088X8`8888 88000h0x0HP(0880 0 80 8x00( 8hpx@HPX`00 04 0 08 0< 0@ 0D 0 0H 0L 808(80P 0T 0 0 8@0X 8H0\ 8P0` 80d @H0h 0l 0 8X8`8h8p8x88888888888 5"Qa 3  D$   T } wE "  W `h 8 {   L   R I  0  C O C   d_    A      n   ]  N ID p G   P&EC$   C     E4 !p" S" N  RM" H  #c J  D" [" V  mW" R  Q$IC R%T&E C' 9(SD) !*D W+C, )C-\+C, EC.)F;"v " _M  K  M& K N/I6/0^Pq1 Db2Z iV NF C3<  I1 Cb2] K" FCUJ"  FF; Ea*C #   4 4 JE@@ 51 X   D ڠA*N1 Cp(v^6 ECb6 ECS++6 EC5%mYc^YTO"&%3CB&* #>!A "E D$AN H$C!T E"C#7E "E E$k8c  %E&M 'E(C)C)[9^ O+*E*C+C+8:S E,C-`;X J8E*C+C<  d==  1E>s  NC?@D P AB1?>@ 8CC0  D..D..D..D./.D.0.E FE"GE HEIE5JEKLEME)NEBO8P8AQ8RS8T8+UVWVXV6D..*A11 E Dk >YDVD1KDZZ>BB$DYD D..D..D..D../D..0D..E FE"GE HEIE5JEKLEME)N[BO8P8AQ8RS8T:+UVWVXV60 \A \.] ^ _ ` . \. \1a 1 b c d . \. \1e 1 f g h i .*AZ ~ ..8 ]jV ^k _YE `Fl amn bop cqr dst fuv gwx hHy iGz e\ tV) K 5( dK&$  M C{| AB1?>@$ p G}, 'H    ,  C~L      fg   4 22' EI( 'YbW'Nըread_itemQread_line$read_nbytesơТǨread_record,reinput_check֨setask_file_numsetask_file_strOsetchannelШsetchannel_subDskip_restרswitch_fcbsmswitch_windowtext_defaultsӨto_windowǠơˢɨto_window_sub0unsaveܨwrite_item&write_record5activate_context̨add_aliasŨadd_to_historyǨalias_index˨breakupFclose_all_channels@HPX`0 80X88h0(8888088x8p80`(80p@00088080800x00P00080H80000008000p88h0000 0(0088X8`88P008`080@080@0H0P80X0`0h0p0x080000000(H088h8p8x888888@88880H000000000000000 0(0h000`08808(0 @0 8(8X08(8@8HH0p 0t 0x 0| 8080< 04 08 00 0@ 0 0 0d 0\ 0` 0X 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P888xX0 8X8`8h8p8x8888888T W1 5  kF !w]n  |T P 0        !"#$%&'(&)*&+,&-.&/0123456789:;     <<< !<"#$%&'(&)*&+,&-.&/0123456789:; =>>$ ?A?     @ !"#$%&'(&)*&+,&-.&/01?AA?     @<<< !<"#$%&'(&)*&+,&-.&/01BB, C E F D1A "?, JGKH?BLM G@IGHBIF&NN4   E FOH FPO=EEQOnEERO_ESOUEETOFAOUOAJVIWDADXYNZHOFYO:OPEZOpOQEOfORJZ[\\OWOSJZ]\\OHOTCO:OEOpOPE^OfOQEO\ORE_OROSEQOHOTCOFAOBOTDBDBIINOT O JEGI`DEN`D0 XJACCDvBINODNOC4 XJADDEEF ENWEPNMEQNCaNO\FO\DE  XGACC CHHQG CH44 bx\ \A\ \DDG ?m QCaV\ \ OOEOOFKBG8 GG^GCccccG,CCGCd C d     ( d;HGHII;IIBB3C BdIIBBeG BDBC WDdFG.   < HHdfgBih\ c jjjcjc\c\h\Nkl\ ccc jjjcjc\c\k\ON`NO`O N! O"#$d\\H%&'XXEWNd\\H,H\\dH\\dHd ( mBm3N(,BM IIdII3FdB  II3N3 3)   [J>KG?HLM@>GH4 VJWE X^YOZJ OYOHH OOHINAN HHnOHo\O\BIB` T Dwws wwwwuEEECxEr sjss jcttyw s&zwzFs&stwEWppPpppCApAFpttv sjssj1FEXw ϟǟΟ̄Nc`Rtyw s&zwzts&sEFEqtqERFHvCxEtr[VcFYjFsuBC EE sDsqrr8 )FD\N\d{OO|c c))N}EDO~vDcc`N)NOOKOc)Nc)N|NNNF) CECCӨcontext_mode]context_sourceΨcontext_switch@create_context=echo_strɠɡġâ٨fontinfoGget_mouse_state'get_any_mouseIget_point%linput$vbackspace.linput_prompt$ڨlist_aliasƨmove_in_lineƨnew_filenameǨpopupŨprint_commaCprint_eol+print_flushʨprint_line˨print_str\setup_runƨstart_echoŨstop_echoΠȡѨstrwidthSunhideͨlt_scanmpy10uabs00(0 08(0H8 080(8 0@8080088(0800880@880H8@0P8H0X8P0`8X0h8`0p80x08h08p08x08080P80X80`80h80p80x800(80 0H@(8@H08H8888PX0`0P0p00x0888880`0000X00h888888p88888PX`x000000P0(88h880 P0( (00 0 0 0 0 0 0 0 0 0 0 0 0 08@0d 8H8X8`80 0 0 0 0 0 0 0 @8X8`88888888h8p8x888Iw| } 0m z  X, QC NE C JD D#  *+,         -,F.q/l0g1b-,\222222223+, 9:9:c9 :9:7 , 7 99*9 999;4,79::*::::;:9:5 99*99;69 :9:c 9:9:8 8 ,,89 ::*: :::;:9:499*9999;599*99;6d9 :9:7 9:9:8 , 7 99*9 999;499*9999;5 99*99;6 4 5 6 -,G99*99*99*99*EA<=HGH99>99 G99>99! 99$!99%?@)?@E 9!:::9:"!9 :::9:#"99'#99($%'('$(%" #!H99>999999'G99>999999($%'(EAC2+,EC         CAF2-,H3.E.F/A/E/F.A0E0F1A1E1F0A38 -,A B.C.B/C/B0C01C1BMH:B8 DE DEFG FGC D CDC8 -,ADEFG  HB;.0/1B  IIII, ,J,K,$  , ,N ,&$$  , ,N ,&$4 ,\^B B,'@  , ,, ,N ,&$4 ,]_B B,'@! , ,,,N ,&$ ,J4 m,J"#$,"#$*,BC,L( R,,Ga,LuLJLCWJL%&MDN*NL,L0 Y,OB,B[a,LILDN*NL,L< J ,O,,\B,5@ ,PHJQP,CON8 J!,BO,B,],5@ B,PBHJQQ,gNEL,EONX],B BQRN$ a*,I ,JNI,CSZNOU ,JNTS, O,HJSHJS H@J  U y, y, &VVWF&VV  EXEYI,P0 -,F)IC,IIG-Z[\]-,H^_BHuB^EB_J^B_-,G3.0/1A+,~& ` a b a b c ` c Ad< '',,'BB,'BN,B,  4 (,, eQfL( CgI('',W(Cg [ 'BB,  II,ICh  GI,IChH  >3K"">P"" iB,,,f)BjB*NKDB,BkBCR d 1H,K 0F,B/H,K.F,1HR,K0FR,/HR,K.FR,M-,G2 2*[B*R*I*A TBZ11XY00zY//\W.. -,G22 <=8 =<A k kBBBlBBNKD,m0 ,IIB,BIIBBCIIBBCIEBLIRI( onnIpnIBNnDnn',Iq0 #BBRCIB@BrR,,##+E,sCs,,##+E,,"# B$#$##,##"'"D-*"**-( %AP&A=btFuCvEHVuFuC nn$ -,AII.XI/S0N1I5I.0/12  II  ,I./I,@$ II  ,ILQKI/4IO$ 0,HI 0*IB+,H*0| ^,^*`,`*Cw,*, P,,bCx,yCxy*-,D ,, P+, *,wzC{C|}C~C`1  ""[  ""zC{C|}C~C  "" F  ,PC C*^,!!,PC!C*C Ct ΐ""",PC!C*C CL  \,#$I%II*s,,,0RX&ICJ1A**BtBB,.S/N-,G22F#T  ^,^*`,B`*  ,B,,{BR  P  H,WU~ըangle֠ơ΢(box_drawbox_keepRbox_pixelMbox_show;ceilԨchain_start(chain_numա΢Ȩchain_strա΢Ȩchain_arnumƠۡݡ΢Ȩchain_arstrƠۡݡ΢Ǩchain_endͨprog_start?prog_num!ܡעԨprog_strAprog_arnum ͡.prog_arstr ͡Qprog_endHprog_errϡȢҨunsave_chainfileŠšΨchain_oldɨuser_check_keyʨtb_check_keyɨchk_exdataըchr$ݨclear_windowۨcolorstr$[colornumנơâScotʡâǨcscʡâƨdategdraw_clipped_lineHdraw_clipped_pointӨmark_clockΨread_clockNepsѠʡâʡâ!eps02exline$knextext$doextext$Ψflood2fpͨinit_runtimeΠšǨipרltrim$%make_sound@mat_plotfill_polygonload_polygon(08@H0(0P000@HPX`hpx (0`80 888888x0P08@HPX`0X000hp8X`8 8(80880880p8@08H00000H000 (0(00088888 8P8X8888800H0@0000H00P0X00`0h0p8`8h0x000hp8p8x88880 0 0 (0 00 0 0 0 0 0 0 0 0 0$ 0( 0, 00 04 08 0< 0@ H(80H 80P 00X 0` 0h 8@H80p 0 @0x P0 0 80 0 80 8P@(888888} 9 qA m ( t T  3a' " | G|<$l \""#0#@ v    T F&o               d   qBf     se       x`     M          PPPP8  ^^J\\wgECC ,  \\C (@,  ]]C (@$    $ ^ \!  $ _ ]!  $ ^ \ \"C( ^^ ( __ 0 ^#E$J%!@EDP0 _#E$J%!@EDQ4  &% T#C$&P4  &% T#C$&Q, ^%+@, _%+@0 \^'@0 ]_'@0 ^  N^ " ( ^P< Q   )@  __    Q)4 I  1D   R  (S&'E(F&L C)  Z   S&'E(F&L C)  Z   S&'E(F&L    uJ  xR   CaC   G  H CQ CL *I     P  * 8 \/@ED   8 Q)8 Pb   P J    Q   )8 C+]  T    I C) F E h MH I r   MH I S&'E(F&t  --X..,..,//x..00V1212..,$11P   C)V$S&'E3F& t   C4 PP --P   ..Q  ,,) 5 b&'F5(&6F76&  C57^  //x  00Q ,, )Q&'C(& ..P//F .. 00_ .... L ..  C6 88r99H.. ..-::Z ..-..-- .. ;;_.. ..-<<Z ..-..-- .... F ..K..==k........ ....C6s..-.>.>R----(\   Z  b V    $H C  E    V    $ P  C?P P Q  ) \&'H@3L&6D4 ^  F@ 3 75C3 %"A @4 I1l CB !!--i..  ..  12B"T   ! \  B"T   ! \   B"8 K  /B" &CCDCECCL #   uJ xR  CaC $  G  H CQ CL *I% #   P & *& 8 ]/@ED    4 K' /< S! (  '4 SC ) '< [C! * 4 K+/8 XH C , "8 XH C-"@ WF ! . #P   F Gn UG  UG CHXHIC=HHHE/ f!.!EHBS/    ` W !.# C0P   F Gn VG  U" CHXHIC=HHHE1 f!.!EHBS1    ` W !.# C0   D 8 F d!C   D ,  S&JEKF&  *8 G&DSNGIG2CL MDNODP$  O& Q &  8 GH "   "  " "" "  ""  M M" M  M"  ( ""MM"""" "" M"M" 0 I " " """ M MM" ( MMM"M" 4 345eRfRSSTUUVVWWX\C6 S" V" U"" TM WM" XSYUZS[U\VYTZV[T\WYXZ]]W[X\^^Y[Z\__`68 ] ^Z\[Z\Y [Y[ZY\S&'EaF&L  7 bkcCcdEeECfQ"MD7X7[7O# #IHGFEDCA%gBh iK 7Cj kL l 7/ nm 8 mPm 8"gg7 gg7ѐ7iCoqB"pg77iCoj77iCorn7x7Vjhmcsm^tmYB%PON&LKJIH"F%DCBA%o7y<U.D*(&$" f ?EA<D<C< Q7C3 << H<< @QF<4uAd< 7 D BI!LD<C< nOBEC G3) L3_CN L     ; ;;7;7 ;;2;2 ;;&;& ;;4;4 ;;D;DE;;.;. ;;F;FE;;G;G ;;H;H ;;I;IE;;:;:E;;J;JE;;K;K ;;8;8 ;;L;LE;;M;M ;;N;NE;;O;OE;;@;@E;;P;P ;;Q;QE;;R;RE;;S;SE;;T;TU;;V;VU;;W;WU;;X;X ;;Y;Y ;;Z;Z[;;\;\ ;;];][;;^;^ ;;_;_ ;;`;`[;;a;a[;;b;b[;;c;c ;;d;d ;;e;e[;;f;f ;;g;g[;;h;h[;;i;i[;;j;jU;;k;k[;;l;l[;;m;m[;;0 ;p2oo27oo22onof;3o2oo27oo22oonr;pm2oo27oo22oonH Cs onErqCt noqr! n" q## o## r##$%>&?##'()*+ C n q##,uK u-on(rqv @( .yyuK u-H  /yy* Ez i*(.xzv.< x <0)*(.{zv.  1+,.x6|. M?@S?A@n EBK n; $ %  CԨplot_startǨplot_stopplot_text˨powerڨps_setcolor{init_ps_cmapps_color_mixbegin_postscriptps_restore_originܨps_rescaleend_postscript;ps_default_fontܨps_setfontreaddata_num8@HPX`hp8@0(8888 8H8(8080 8px8x888808888@8H8P80p8X8p8h880X8800P0H0880`000(@00000888x0x000H0000000000000(00000H00000080@000 0(0008000@0H0P0X0`0`0HP0X`0h0p8`8h088p8x888P8X000 (0 00 0 0 0 0 0 0 0 0 @880 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 80 0 0 0 0 0 0 0$ 0( 0, 00 08 0< 0@ 0D 0H 0L 0 0P 0X 0\ 0` 0d 0h P0 0p 0t 0x 0 0| (88} $   0  q 0 D 0 0 CCQ& C& (   8   C $  H  "#!### %!##"# ###$"#$ #$'#(###&'*##(#&###)(#) #)$ #+,#)&#-.## #//0112,# #334-#Ȭ 7 8B9F $&)( P( Q$ :  :C;4  C< =  D  BI ! ( >  @ ?AB 0CD EF GH 2IJ 4KL 6MN OP QR ST UV WX ( VBY :Z BY:ZS&[E\F&   ##  ?0    2  46          4   H z   O Q  C](  8    H]    i A  E  E]   H:## C\( ,  N&^C0 J r m15M_`C U]Ma`CC`@ :cs ,.  +-b D bD b dd bdd:]Sefdd ghddt:Sifdd jhdd\k BCll dfdddhfOeJhEgCmijjhn,ijoF0  G E WEME=Cp Erqk Esqa E=qW EqM E qCpDbtrq  q @ :]O! %*'g:O, +.-S Cu ECv!% *' ,+.-P&bdd b dd=wdd=x : D : D    I * :oF: :HRo oH  P D  bPbzKOb d O@ dbdb b^b@Yb{! {  y y""! =  y y b `Ab{y{W ==b{#{"""" bbb E$ C%  "" " b&"&ըrdnum_ansi٠ɡѢȨreaddata_strרrdstr_ansi#recompute_transformۨredimnarr٨redimsarr٨remainderҡâȨrepeat$7restore_transformround6ӢǨrtrim$Ѩsave_transformqscan_itemmscan_item_ansiϨscan_quotedpsecʡâǨselucase$Ψset_substringǡ΢Ǩsetask_color_numAsetask_cursor_pos̨setask_text_justifyԠXĢبsetask_viewWġТרsgnܨsoundߨspaces$$xstr$8@HP0H0(0 0X0x00(00@HP`0h(08p888x88888888h8P888p888X88x88888 88088(88888@8H8(000`08800H0000(080@0000000080(0000000@0 00000088x8p0x888 88 8(88800880880p0P0008800(0 (8@0 H00 0 0 88`8X8h8880 0 0 0 0 0 0 0 8p8X0 0 0( @0 0 0 H00D^Q G n }  2$ NEG     E G  x  n E G VLEG 4 *I C  EG EG   EG   EG ~EG f\EG D:EG "EG EG  ! !E G "#"#E"G $%$%E$G &x'&n>ȝƝΝ 20.20.6LJRhfn֞ԞҞڞ (&$,B@H^\dzxv()h*+,-./0123456789:;}<=s>?i@A_BCUDEKFGAHI7JK-LM#NOPQRSTUVWXYZ[\]^_`abcdefghijklmnoy*po%žʞҞڞ $ (08@HPX`hpx*J*p1qJ*p18 =vvi wrs sxturtu$ y( RB rrrrzrB rrrrrzS&rr{E| F&rr 0 z rsr}t ts}t t ( ^\rrzC~ , EyC^r\srsrrzC~ ( _]rrzC~ , EyC_r]srsrrzC~ Ԩreduceͨtime$?trim$٨truncate.ӢǨtwodigits$"uboundnԡâȨuboundn_old͠ԡâȨuboundsԡâȨubounds_old͠ԡâ(08@000000000000H00(0 0`0P0p00x00X0000H000000000000 0(00080@0H0P0X0`0h0p0x00000000000000000 0 0 0 0 0( 00 08 0@ 00H 00P 0X 0` 0h 0p 00x 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 00 0h0 0 0 0 00( HPX`h00 08 0080000@ 8(0 00 (00 0 @(({G(,   CEMH  ]  a V       E D   QQQ  cT C   L J Y    ^ a\     n    C     Q 8 C]X   eOCYPJ +30     4  H   0 SEED  EDEEF   F C$ P   S ! !E C"   S " Cb#> y  e "!!PJ 4   ! $!$D  8 C`[   eOCYPJ +3|  ) !11\W"" EC$$I'!$[!$11''K$11C2D$!!+++H,F,,FH+++D!+++--V,-113C2++S,K+"FC+1 414(+ !!C2))C2)"E +%+I!+&L+C%!+&+5*"5l**! !,,)P)"E**%%J,6BC2+1111C2%&..C23]j"" EC"P, #E/+++D!+++11Z#M#C2/++C//D$+1 414($1+1 7*7l**!%!,E2U0b)E,)H,)C2&,,!!**%%I&&**c0C20V,*C2%&..C2(V%Q.L%%(( V`$G"L'G#o(G$]'E)S$H$TD$$C"$  *+ !&I&$*C&$ .F.8*9:+:A +/./u +// +//+//..;,.<;-.=;..>;/.?80C+9n *,-./09E9D99@@9Q Q Q Q 9/./ 9// 9//..A,.A/.?809/./E/*$D$1(/F.h$N-@@,,1N,-@O$@,41411,55E0-C1- 52-2- -@.@11C"1B+BG-3,/0,-!F1-5$E5R!5H$CC3!_O$5!44H141!!,/@1@C!/0b!!"(&@@JCb#HCbD+ 22!22 + +@ *E@ED((P   b4Bz!!X Be!$$!!!!$$S!!5I"T4!CB!d Bp$$!!Y!$!!$\M RK%.3VQFFHFC!!FAFFA F!!` 88S6 E G6$$wCG8*H* +8,I+,T8 J * H-*- & 8 D8 CGK l8 CG]8**8 HE LCGF@@{ ɠ0.,*(&$" ՟ӟџϟ͟˟ɟǟşÚGu HE LBX8J * H-*- 8 O F C  Mh88 HE LBRJ * H-*-  NF O^88 O8P8G +,A08 L` H[J* H-*-!88 !CGD L88 /CG PBJ * * CPW R *BJ** * C D  QN&QQPCRQQ, SJTEUqSWXYVT[\]ZUVZ  0 ^_C__C_``0 a`bcdMeHdeFIfHu    aWhQiLi877hhA)QQQ9:E("u9;E(k9E(jM9?E(kC()QQCl9h  mnSopNgQgQ0 afbcdMeHdgeQFIgfQHugQgfq g   ooorg  pppQbs Q   mmmtQ  nnnpo   uov  ,  B^ M@BBԨusg_breakupԡâ usg_scanLpr_using_strlusing_bad&using_tab*using_casesJusg_print_strͨch_line_len֨using_strϨusing_str1pr_using_numrusg_n_okרusg_sgnxusing_numҨusing_num1"'fill*valˡâǠϡâҨchk_constơ΢ɨwindow_pixelOacceess__Ȩadd_notes1ask_size@check_graphicsclear#compute_hmin_etcexpand_aliasǨfilename$ʨfiletag8@HP0 0H 80H@X`hp0800x00(8808H0P0P(88X0`0P hpx0X 00p080` 0(000@00P0h `0x00H00P00`0p 0x 000 88 8H8(8888088800 088P8X880(880x0X0 8888 888888(00 88(0H8880 0( 0 0 0 0 8h@P0 0 8X`0 0 0 0 0 0 0 @0 0 0 0 000 0hxHPX0 0 `00 0 0(8008 04080<0@0D0H0t 8X8`88 8(808h8p8x888888@8H8PC    G   $ E   M } : " Th!  G & '('(c'('($  $'')''''*! $'(()((((*('("'')''*#'('(c'('(% %  %'(()((((*('(!'')''''*"'')''*#d'('($'('(%  $'')''''*!'')''''*"'')''*# ! " # (  --.,,//+$ 100-,( 2..+--/+1C+3/$ ),,+-, 5..4--//$ 600-, Px1002A074 )-^ .` 44.1F-l8.-4.1R.  -- :9<; ( = >1? @BA1C DDEEFFG1HI*JJ81KKL  M!  0 "$1XzBJ%&&"#C"#C"#8 % 44 E C141H'"o4   O%C4+4  '4 N"  < +4 7+-.144-.8 7+4 4( 7KI aK EJK*E @ E*KC1KKLO Y TP. .K0,- . .K0,- D41K4 JJIUI PJIIJJI qJ1M(C*J_J*E(UJ*P)E1JF*J(J8O TP J-.4  J-.41TB J-.4  J-.4 D4 J& mB J-.4 - . 4*@ +,d-_!ZU.P/K0F1A C K.F() C K/F(2 C k0f I1QQL *JJ8 C(RJ K C r1m1QQL *JJ8 H(*IC:IJ Kj!C  BS O1  CT F11U K01uVW....B$ $1 1  XYZZ[0W I1QQL *JJ8M E\ICI& CJ!FC1FS A 1C I S1 XXZZ]]^1_<[BY2 C(11C < +I f+1J(C*W+*E*M)E1C*7 o`4`` I74G174a I74G1744```< є#&&3C#I p#&& N * *KW#&&N1 1K@I O 1O#% 1[$%&$&%&$&$4C13I1;I dK))R E H*@R O1OG m)wBQI E#EK#OI E#EJ#$ + Z'5E aC1a a-0-Ma1E6'C5'$ 7BJ F7D),-h!rm.h/c,^-Y0T1O,#'+/8C  < '+.N9E:Db;U+< 14 +  +cF 4d1E1Ce41V1Q1LVW f=O.1E.fCgR>M.1E.hCg:E.L9G+..+., +M& K M? +i& Y+1E@O +AB8 +440 2Cj 0 )C j0 2Dj 0 )D j0 2Ej 0 )E j, 24F4j+, )4F+4j, k4G  )14j, k4G  ) 4j0  1'k1H< 441E+I4 N+,  1'k1+8 !"#$ 1% l& e $$$CI$'$J&& K&K&&L&(&M$#Bo &&NE 1V $&&O&&&(&P$Q )J$&S&R(R*r8 j 14 1Bu]N.P.m1+$Q$.+4  +. .41+.$Q$.2P ++TG)++U  VWn2,, ,,o,,pD(qn,^,rl&22200  ],רfill_circlesetfontިaskfontӨsetfontsizeߨaskfontsizeШsetfontstyle"askfontstyleҨget_keyبgshadeNinit_interface˨init_modeŨinit_sysUlegal_filename$Ǩlegal_afname$Ǩpathname$/pathpartsTprinter_closeƨprinter_output˨readimageިreadpixel!readcpixelڨset_background\set_color̨set_modeset_ask_color_mixsetask_color_str set_cursor3setask_modeXtext_eofmarkŨwindow_colorǨwinfoĠơ΢ϠܡƢqsetlinewidthۨsetlinestyle-writeimage+get_window_brush*set_window_brush*get_window_brush_color*set_window_brush_color*get_window_pen_color*set_window_pen_color(ask_pointer$set_pointer%release_pointer4take_pointer6sys_environmentBsys_sysinfo֨ mainՠǧeħʢ̨read_argssrun8@HPX`hpx 80 (08@H8PX0`0X08@H8@00(0P8HP0p0(8x8080008080H8888p888x8888`008080x888P8P8X8888 0 8 8(80080 0 0 0 80 8880H800800 0@00 0 (0 00$ 0( 0, 0 0 0 0 0 0P0 (8088X8(88 00800X888@8H0\8P0`0d HP80t @80h0l0 @0<0@04080D0H8h0p0t0x0|000000000, 00000000000H0 00 0 00P00800(08X8`8088888888h8p8x88888XX} 9n : Q 0  I|E " qw  x    /e z [  A M  T ST      "Ҩ-Main program Àĩ-thisprogram in Main program H H H` H@ ( 0HHHHHH((P((K 0,,,,, Ҩ-unixparts start-upv0    !     ը-settextfontƤåƤåƤɥɥɥ@H 8 @XH H P X ` h pP(( (((08( L4@DDD  Ԩ-stringwidth08H(8,0000 Ө-setlineweight(H0@@@@( ֨-boxdisk(08@)&D'X'h'tk       ef gh ikljjnmpqoosrut]v\wyx z{}| ~ t} xko #mr  c ̀ Qjr)_r΀ Ѐ̀̀̀ ΀ ̀ Q ΀ ̀ P^Ȁ_bm̀oπ̀̀ǀ̀΀ɀ̀̀ ̀Ҁǀ̀Ӏɀ̀̀̀o_‭̀瀭̀̀̀ ‭̀瀭‭̀瀭]‭̀瀭 j́ ŕ ́ ́́ ́ ́́ !  " #$ % &&'(()**++,,-?@A2Ɓ3d4444ÀĔ563H56ƀ7I56Ɓ58Ɓ69JƁ2 K32Ɓ3Ɓ2 K2H56ƀ7L563M Kȁ5Qʁ5Iȁ6Aʁ69N3C&'*+O*+,->P,-:;G:; ȁ5ʁ5ȁ6ʁ6N3Ɓ~&'*+O*+,-P,-:;G:;,-ƀ=Q,-',-3ƀ R<,-ĀƄƀ< ] R<*+Ā**ƀ#S,-=>ĐO=>,-Ɓ? ',- T56ƀ7U3"#CV56ƀ7XL563΁6Ҁ̀ ,<-<&'*+>O*+,-P,-:;G:;W56ƀ7CO*+,-P,-:;G:; @Z563ƀ7 [3\?"]563ƀ7^3L563 "("  " (" " !("##%#&%&&& $ " ) "G+, " / "12 " 5 "G68 " ;("G " B "DCE " H("JJLLIK " O("PQSSR " V("W XYZXY[W XYZXY[W\ XYZXY[W] XYZ XY[uW^ XYZ XY[bW_ XYZ XY[OW` XYZXY[B 2 "I56ƀa56&'Ca56()DʁDc `(),-vʁC_`&',-&``56,-_56&',-1,-&E*EF+FGEFG_,-*+',-E*FF+EGFEƀ a56&'CʁC_`&',-_&'56 `56,-_56&',-1,-&',-_,-*+E,EF-FGEFR<,-Ā(()`ƀY`56,-_56&'_,-*+1*+&',-E,FF-EGFE< ] R<,-Ā*@"cHIJKOƁN 6ƁLƁM(ЁLQRMSKRSP PJKd "STU=>Ð_VW()O=>,-0"XYЀ\]́X]ZЀ\]́Y][OXY^_OZ[`aeZ[]Ɓ] eZ[]Ɓ]  ??ftvxw^_`ae^_]Ɓ] 5e^_]Ɓ] &P^_bcP`aVWbbcVW?` "duu_efijPijmnmnduugv 6_ijkl_mnopƁd*wƁw ȁ'kjgijstg hijstgPijmnimnwƁw ?iopwƁw mn$ftvxwijklPklqrqrmn2iopwƁw !ftvxwklijPijmnmnxy3{zswʁwztwʁwz!iwʁwvjwʁwwƁ3 |wjw0"}~Ё́}}Ё́~~h"ҁЁ́Ё́Ё́Ё́Ё́Ё́́́́ҁ_́́́ҁ_Ё́́h"]_ҁҁ_kƁ#  orjmn`ƁSЁQKĺ́΁΁h  G-eulersmethod) 'Ƥå[_#8 $$4ǤФФåǤǦǤФ##ǤǤʥʥȤ¦åǤӥӥӥեեåæƩ-setcolor in eulersmethodsǩ-dydt1 in eulersmethodǩ-dxdt1 in eulersmethodǩ-dydt2 in eulersmethodǩ-dxdt2 in eulersmethodǩ-dydt3 in eulersmethodǩ-dxdt3 in eulersmethodǩ-dydt4 in eulersmethodǩ-dxdt4 in eulersmethodǩ-dydt5 in eulersmethodǩ-dxdt5 in eulersmethodǩ-dydt6 in eulersmethodǩ-dxdt6 in eulersmethodǩ-dydt7 in eulersmethodǩ-dxdt7 in eulersmethodǩ-dydt8 in eulersmethodǩ-dxdt8 in eulersmethodǩ-dydt9 in eulersmethodǩ-dxdt9 in eulersmethodǩ-dydt10 in eulersmethodǩ-dxdt10 in eulersmethodɩ-fetcheq in eulersmethodƥɥɥɥɥɥɥɥɥɥƦũ-w1setbounds in eulersmethodǥʥʥʥåĩ-w1init in eulersmethod-ĩ-w1keepfieldlayer in eulersmethod7ĩ-w1showfieldlayer in eulersmethod;ĩ-table1init in eulersmethodUĩ-tb1refresh in eulersmethodZȩ-tb1store in eulersmethod_Ȥĩ-r1init in eulersmethodǩ-resettstep in eulersmethodǤʥåƩ-keyinputinit in eulersmethodƩ-keyinputvalues in eulersmethod##ĩ-mousecoordclear in eulersmethod*Ʃ-mousecoordinit in eulersmethod.ɩ-mousecoordvalues in eulersmethod=ǩ-delta in eulersmethodF*ɩ-swapdelta in eulersmethodKΤƤå¦ĩ-buttons in eulersmethodnĩ-stepbutton in eulersmethodtĩ-stepbuttonclear in eulersmethodyĩ-initscreen in eulersmethodĩ-w1rollover in eulersmethod#ĩ-w1mouseclick in eulersmethod,ǥǤʥåʥǤåʥȤ¦å̩-drawvector in eulersmethodwդƩ-solutionvector in eulersmethodɩ-setvector in eulersmethodޤåޤ˩-trajectory in eulersmethodɤȤդåϤϤååϤå=æɩ-euler in eulersmethodɩ-rungekutta4 in eulersmethod!!ĩ-slopefield in eulersmethodǤܤܤΤææå x ( 0(H(80(@80(80(@80(80(@H80(80(80(80(80(80(80(80(@80(80(80(80(@80(80(@80((08@H H X h 8 @ HHH H(HH H  H0H H( HH HPH`HX 0HHH HH@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@HxHHHH( 08@ PHpHHh(08@(0H H H HH HHHH(08HH  (H8H HH H` 0Hp 8HHHH pHH @HHHH(0 (HH0 H8@H8H PP XX`hpx08@H08@HPX ` `(08@H08@HPX`(08@H(0HP  h( p08@ xHPX`hpx0800HHHH(0H (08@HPX`(hp(0H(08@HPX`xHhp(0(08@HP(08@HX`hpxP   (08@HP(08@HPX`hpx(08@HPX`hpx( (($0(((,(08@(4(HPh(8PPX(<XP@(@PH(D`(Hh(p(L(((P(T(x8@((X(\(`((X`XPX8XXX@X0/:JUep $4? ./ GH)*B f }   h rs ; MQ Rn  I JR   ] 6 S zd}j"#X$- (a `,giq{|+~Y&[p>%e'0,,,,, Ҩ-interface start-up|Ltttt8(    ֨-infowithin%@80(HHHH ( P0DDDD Ө-infobuttonup-(HHHH`|Ltttt8(    ֨-quitwithin1@80(HHHH ( P0DDDD Ө-quitbuttonup9(HHHH`$80     "     ! " #$&%'%)('+*%(*'%&,'-,).*/,./-Ҩ-toolpanel?HXHH0 H` (HpHHHhHx 8H8H@ 0@HHHHPH HH  P XH HHHH 8H HH H HHHH(d((h(lP( ]XC(       Ө-settooltitlek HH 8Hx@Hp XH ( P  @H0(p( GH   '        +      ը-copyrighth  8@HPX X ` (hp x  (t(0(x0                    ר-rim$$(08@H H PX (H  T||||?0   ר-hrule(08@HP (HH ||||38          4        1   !"!3#$%&'()*+,-. /#0$1%2&3&4'5'6&7#8&9':Ҩ-palette( 0 8 @ H P H H` (    p p      x   (X HHHHHH H(H0H8H@HHHP`HhHpHxHHHHHHHH,((((( Ҩ-help start-up%<,hhl#         Y! #"#J"     $ % $ &$ '((*)+ &'(),-.,&,'-)-( &'(). ,-.0" 30/554667!87995 577!3775 65 ::;88;493 69  !<\8PTTT!  Ҩ-w1showgridlayerH H(H(0 P0'`<TXXX!  Ҩ-w1showgraphlayerH H(H(0 P8(tDhlll*(   Ҩ-w1keepgridlayerH H(H 0H(8H0@P0)tDhlll*(   Ҩ-w1keepgraphlayerH H(H 0H(8H0@P8*X8HHHH( ֨-w1pixelstomath(08@+ !d@TTTT'( ֨-w1mathtopixels(08@H,"#X4LLLL!  Ԩ-w1wclamp(0HH H0H(-`E(    Ҩ-w1variablesHH H(H0HHH8H@HHHPHXH`HH(0HHHHH8@Hh Hp.123"#d#(      c0- c0  -   ը-w1drawplane(08HH H(H0H HHHPHpHHXH`H  (HHHH 0@HHxHHHHhHpH/45698;:7844444 Ҩ-graphingplanes start-upPxxxx;8     ڨ-wndparams(08@HPX`h 1xHpppp38   ڨ-fncparams(08@HPX`h 2lDdddd+8 ڨ-planeratios"(08@HPX`3\D8     ֨-graphplane)(08@ H P X X` Hh (Hx4 X    4 ("   ڨ-xgrid8Ʃ-wndx in xgrid<ѣ(08@HPX`hp0(8@ x (Hx5l54((((X    C  ("   ڨ-ygridLƩ-wndy in ygridPѣ(08@HPX`hp0(8@ x (Hx6{60  $$@ *$     _Y  +     $      1-zeroaxes08@HPX`h p ( 8(7WP %   ( "     ܨ-edgesvrt(08@HPX`hp 0 x (8?@P %   ( "     ܨ-edgesvrtpi(08@HPX`hp 0 x (9?BP )    , &      ܨ-edgeshrz(08@HPX`hp ( x   0:CDt\P         ܨ-edgeshrzpi(08@HPX`hp (x  ;CE400000 Ҩ-mathgraphs start-up|Ptttt;0   ٨-withinwndXPH@80( ( =|Ptttt;0   ٨-withinfncXPH@80( ( >pX```X        S   !5 " !  S ##!5 "$ ! $(" ݨ-vnumberlinetiksƩ-wndy in vnumberlinetiksѣ8@HPX`hpx0(8@ H ( 0 (0?A?pQ        !"#$      %&&    &&& &'' &&(( 9 &&! &&$(" ݨ-vnumberlinelabelsƩ-wndy in vnumberlinelabelsѣ@HPX`hpx0(8@ 0 H ( X @ H 8(0(((8(((@:@A I|Lhttt00   Ԩ-decimalplaces\8@H P (X((0AtT       !"  ##  #$ $ %% %&' %'''' '(( '')) ''*+'&% '%+ +,  ++-  |+. h+/ T+!<+6+00+**+$++1+&+2 + +3 +45 675 7"5!6477"f56&6%%47"848%%7:5%%5%%647"848%%748%%1%%7" 4%%7"V"(" 3-vnumberlinelabelspid Eũ-pi$ in vnumberlinelabelspifƩ-wndy in vnumberlinelabelspigѣhpx0(8@ 0  H ( X @ H  8(08 @ H P X h @ PHPX`h(0((8((@(((((((HPX(`BBB IUG,4h      g   5   g   5   (" ܨ-hnumberlinetiksƩ-wndx in hnumberlinetiksѣ(08@HPX`hpx0(8@ H ( 0 CC|]       !" Ŕ ##  #$ $ %%  %&'%'   ''' '(( ''))a '' ' '!''''''" ' '"(" ݨ-hnumberlinelabels Ʃ-wndx in hnumberlinelabelsѣHPX`hpx0(8@ 0 h ( @ ` H 8(08((@(((((DFD GIX$ptt       !"# ۔ $$ F $$$$   $%& $& &&& &'' &&(( &&)&%$ &$  *  {+  k,  WK-  7.  #/      "$$$$0 10 #0"12$$#f01&1$$#33$$:0$$0$$1#33$$3$$2$$# $$#o"(" 3-hnumberlinelabelspiQũ-pi$ in hnumberlinelabelspiSƩ-wndx in hnumberlinelabelspiTѣ`hpx0(8@ 0 X ( @ ` H 8 ( ` h H P X08 h@(08@((((( H((((( ($((P(,XEsE|E GUI400000 Ҩ-typesetting start-uptLhlll2(  ֨-plottextlj(0@ H8 (H8GtD`ddd-0 ֨-plottextcj(0@HP X8HGd<PTTT%0 ֨-plottextrj(0@HP8IGDdppp08 ֨-aligndot 08HP (X`@(0(JGt<dddX           q              Ԩ-measuresupersubPX`hpx ( P 8H(08(4(8(<(@@(DK T8DHHH( ֨-supersubscriptlj(0@8LOpD\```(0 ֨-supersubscriptrj(0@H P8MKOLlppp00 ֨-supersubscriptcj(0@H P X8NKOHh                          ֨-supersubscriptHP`hpx ( P 8 X(08(H(L(P(T@(XO GL<88888 Ҩ-numericinputeditor start-updJH         (ר-monostringn8@HX ( P`hp xP(\(0Q H0 YF   Ԩ-formatnum8 HP p ( H@((`(d0(h(l(p(t(xRS~(  !    Ө-clipspcandzeros8 (@ h0((|(SlD`dhh! Ҩ-mathsymbols start-upF HH `HP HH@ ((X(Lttxx?    Ө-pi9w ( x H p 0 (U400000 Ҩ-graphparts start-uppHddhh7 Ө-arrow3 0 (  0(W( ը-plotdiamondclr((08 @ (HXP4DDHH# Ө-vectpntm  (Y0,,,,, Ҩ-clipping start-up4,,,,H   k e     3 -  ڨ-clip(08@HPX`hp x[400000 Ҩ-interaction start-upv@              ب-drawbutton(08@H H (X`HHhpxHP(]HTxxxx?(    ֨-buttondown(08@ HH (H^Txxxx?(    ֨-buttonup(08@ HH (H_p@\\\\)0 ר-mousebuttonup(08@HPX`^a_L4DDDD  6ը-mouseup(08 aP8HHHH!  6ը-mousedown(08 b,((((( Ҩ-timer start-up )dD\\\\,  ==0Ҩ-settimer6 ( 0 (8HXdxLpppp70 = = )Ө-delayG(08@HXH (PXe400000 Ҩ-cb1checkbox start-upQxLpppp7    ը-cb1withinW80(H`HhHxHp ( gL0DDDD Ҩ-cb1variables_HhH`HHxHphT0DDDD Ө-cb1mouseupd(H`HpHHiokL,8<<< Ҩ-cb1initiH`HpHP@jmkL0@@@@ Ҩ-cb1setstatenH`HpHHknL8HHHH Ҩ-checkboxes start-upH PH plQ8        ֨-checkboxdraw08HPHX H (H P`h h@((m L|^@           ֨-checkboxset(08@HHP H (X`hp niH             ר-checkboxmouse(08@HPX`Hh ( Hpx oaP<LLLL Ҩ-r1radioboxes start-upH PH pxLpppp7    ը-r1within80(HHHH ( q@ $(,H       A         Ԩ-r1drawcheckboxesHPX`hpH h ( Px HHHH8 HHHH((0@PH(X8X0r LG @    )    /     ը-r1setcheckbox-(8@HP H (XHH`H HHHhpx0 X8s400000 Ҩ-menumethods start-uppV@    ֨-popuptab08@H PX 8` @h H p (x((u]pRP           ܨ-showequation108@HPh ( Px H X((p`v ILpp   YE          ި-menubounds18@X`hpxH  ( P H   P((0((Hw K,8  Y "!"^! #$ $!$!%& '()*+!-drawpopup18@HPX`h ( PH HH   ( 0 8 H( H@  p((0((xx ]ILG0,,,,, Ҩ-m1popmenu start-up |X0 Y      Ҩ-m1initmenu1HP HH pHH ( H08@HPXHpHxHHH(H0HHH8PXP`PPX@zuwx~xLpppp7    ը-m1within80(HHH H ( {P0DDDD Ө-m1buttonup(HHHH |`X<      Ө-m1resetmenu( (HHHH Hp 0 P8H8PP(}u~G`4LPPT Ҩ-m1showequationHH0HxHHHH8PXX@~vdJ(      Ө-m1markequation0 ( P8@HH(HHH HHp 8HxHH(((P` G4 8 SM GA          Ҩ-m1readmenuHpHxHH 08@H(HHHHH (HPPX `H((P`(b`a~T@PPPP Ҩ-utilityfunctions start-upH (H tLllll6( ը-roundn80( @H H,@@@@!( ֨-clampˣ@80(H\@TTTT'( HG֨-polartocartesian(08@HpDhhhh08   A ר-pythagoras(08@HPX`hH0@@@@( ֨-copycoords(08@H0@@@@( ֨-setvars(08@0,,,,, Ҩ-drawing start-up(X8PPPP$( ר-plotline)(08@H 400000 Ҩ-datatable1 start-up H,@@@@  Ԩ-tb1rgtxɣ0(HH8P0HHHH!  Ԩ-tb1baslnͣ0(HH8 X4PPPP%( Ԩ-tb1midcolѣ0(HH8 @            P    Q    PҨ-tb1variables/HHHH0HHHH ( ((XPX`XX`F8      &Ԩ-tb1init( ( P@HPH @XH`hH ((08XX N\B       +Ҩ-tb1draw7 Hh (HHHHHx(H08tVH 8.     ֨-tb1valuesF@HP (HX`Hhpx @(Ph(08X`I10t$ 8 $ 4$   0<FPTVZ\cflpty  magic_suffix_for_BSDOS2Magic